Dissertações/Teses

Clique aqui para acessar os arquivos diretamente da Biblioteca Digital de Teses e Dissertações da UnB

2026
Dissertações
1
  • BRUNA AFONSO DE AZEVEDO
  • INFLUÊNCIA DOS FATORES BMP15 E GDF9 LIVRES EM MATRIZ DE HIDROGEL NA RECUPERAÇÃO FOLICULAR PÓS TRANSPLANTE E NO CULTIVO IN VITRO DE TECIDO OVARIANO CRIOPRESERVADO DE CADELAS

  • Orientador : FERNANDA PAULINI
  • MEMBROS DA BANCA :
  • ANA LUIZA SILVA GUIMARAES
  • ANDRIELLE THAINAR MENDES CUNHA
  • DANIELA MARA DE OLIVEIRA
  • FERNANDA PAULINI
  • Data: 14/01/2026

  • Mostrar Resumo
  • A preservação da fertilidade é essencial tanto para mulheres submetidas a tratamentos oncológicos quanto para a conservação de espécies ameaçadas. A criopreservação é um método eficaz para armazenar gametas e tecidos por longos períodos, garantindo sua viabilidade após o descongelamento. No entanto, o processo pode formar crioinjúrias, como os cristais de gelo intracelulares e o estresse oxidativo, que comprometem a estrutura e o metabolismo celular. Agentes crioprotetores são utilizados para minimizar esses danos. A criopreservação de tecido ovariano tem sido utilizada para preservar e restaurar a fertilidade quando associada ao transplante ou ao cultivo in vitro. No entanto, desafios como a oxigenação insuficiente e a perda de ovócitos viáveis durante esses processos limitam sua eficácia. Fatores de crescimento, como BMP15 e GDF9, podem ser utilizados associados a essas técnicas para recuperar a ativação folicular e otimizar o desenvolvimento dos folículos. Eles também podem ser associados a matrizes de hidrogel, que reproduzem o microambiente ovariano e fazem a liberação gradual dos fatores, aprimorando a sobrevivência e a maturação dos folículos. Em cadelas, a obtenção de ovócitos maduros é desafiadora, tornando a criopreservação do tecido ovariano essencial para a conservação da espécie. O uso de fatores de crescimento e matrizes de hidrogel em tecidos ovarianos criopreservados aprimora a recuperação folicular, contribuindo para a preservação da fertilidade e da biodiversidade.


  • Mostrar Abstract
  • Fertility preservation is essential both for women undergoing oncological treatments and for the conservation of endangered species. Cryopreservation is an effective method for storing gametes and tissues for long periods, ensuring their viability after thawing. However, the process can cause cryoinjuries, such as intracellular ice crystal formation and oxidative stress, which compromise cell structure and metabolism. Cryoprotective agents are used to minimize these damages. Ovarian tissue cryopreservation has been used to preserve and restore fertility when combined with transplantation or in vitro culture. However, challenges such as insufficient oxygenation and the loss of viable oocytes during these processes limit its effectiveness. Growth factors, such as BMP15 and GDF9, can be used in combination with these techniques to promote follicular activation and optimize follicle development. They can also be incorporated into hydrogel matrices, which mimic the ovarian microenvironment and gradually release these factors, enhancing follicle survival and maturation. In female dogs, obtaining mature oocytes is particularly challenging, making ovarian tissue cryopreservation essential for species conservation. The use of growth factors and hydrogel matrices in cryopreserved ovarian tissues improves follicular recovery, contributing to fertility preservation and biodiversity conservation.

2
  • MARIANA SOUSA MATOS
  • Recelularização de matriz extracelular descelularizada de tecido ovariano bovino com fibroblastos humanos – viabilidade e caracterização morfológica

  • Orientador : CAROLINA MADEIRA LUCCI
  • MEMBROS DA BANCA :
  • CAROLINA MADEIRA LUCCI
  • MONICA PEREIRA GARCIA
  • José Roberto Viana da Silva
  • Cecibel María León Félix
  • Data: 30/01/2026

  • Mostrar Resumo
  • A engenharia de tecidos surge com uma nova alternativa para a restauração da fertilidade de pacientes oncológicas: o desenvolvimento de um ovário artificial transplantável (OAT). Um OAT pode ser desenvolvido a partir de diversos materiais, mas dentre eles, a produção de um tecido acelular através da técnica de descelularização tem se tornado uma estratégia promissora. A preservação de componentes e estruturas presentes na matriz extracelular (MEC) após a descelularização do tecido nativo é necessário para que esse biomaterial possa ser novamente colonizado por células. O tecido ovariano bovino foi previamente descelularizado com a combinação do detergente dodecil sulfato de sódio (SDS) e o hidróxido de sódio (NaOH), e nesse trabalho, a sua capacidade de recelularização foi avaliada através do método de agitação (rotational seeding). As matrizes extracelulares descelularizadas (dMEC) derivadas de tecido ovariano bovino foram incubadas com as células de linhagem fibroblásticas humanas L-132 ao longo de 14 dias. Os resultados indicaram uma recelularização pelo método de agitação, possibilitando uma adesão e infiltração celular, além de promover uma íntima relação célula-dMEC. Esses achados implicam que essa metodologia possibilita a recelularização, além de apontar uma plena biocompatibilidade da dMEC ovariana bovina.


  • Mostrar Abstract
  • Tissue engineering has emerged as a novel alternative for the restoration of fertility in oncological patients, particularly through the development of a transplantable artificial ovary (TAO). A TAO can be developed from various materials; however, among these, the production of an acellular tissue through the decellularization technique has become a promising strategy. The preservation of components and structures present in the extracellular matrix (ECM) after decellularization of the native tissue is essential to enable subsequent cellular colonization of this biomaterial. Bovine ovarian tissue was previously decellularized using a combination of detergent sodium dodecyl sulfate (SDS) and sodium hydroxide (NaOH), and in the present study, its recellularization capacity was evaluated using the rotational seeding method. Decellularized extracellular matrices (dECM) derived from bovine ovarian tissue were incubated with human fibroblast lineage L-132 cells over a 14-day period. The results indicated recellularization was achieved by the agitation method, supporting cell adhesion and infiltration, in addition to promoting an intimate cell– dECM interaction. These findings suggest that this methodology is suitable to achieve efficient recellularization, while also indicating full biocompatibility of bovine ovarian dECM.

3
  • JOAO VICTOR MONTENEGRO LUZARDO BICCA
  • "Co-localização de entradas tectais nos neurônios pulvinares projetados para a amígdala em micosestrela (Callithrix jacchus)".

  • Orientador : RAFAEL PLAKOUDI SOUTO MAIOR
  • MEMBROS DA BANCA :
  • JERFERSON DE SOUZA CAVALCANTE
  • GABRIEL AVOHAY ALVES CAMPOS
  • LUANA CRISTINA CAMARGO
  • RAFAEL PLAKOUDI SOUTO MAIOR
  • Data: 30/01/2026

  • Mostrar Resumo
  • A rápida detecção e reação a ameaças é muito importante para a sobrevivência de um indivíduo. Os primatas possuem sistemas visuais altamente complexos, que foram selecionados ao longo de sua história evolutiva. A Teoria de Detecção de Serpentes (Isbell, 2006) postula que a principal pressão evolutiva seria a coexistência com serpentes peçonhentas. Uma das hipóteses bases de Isbell é que platirrinos teriam sistemas visuais mais variados quando comparados aos catarrinos, devido a um hiatus em sua coexistência com serpentes. Inspirado no artigo de Elorette et al. (2018), analisamos o movimento de traçadores neuronais pelo cérebro de indivíduos de Callithrix jacchus (n=3), infundindo um traçador retrógrado na amígdala e um anterógrado no colículo superior, e observando se eles se encontravam no pulvinar, com o intuito de elucidar a presença da “via baixa” de processamento visual emocional. Os tecidos foram processados por meio de imunofluorescência e observados em microscópios de epifluorescência e microscópios confocais à laser. Ambos os traçadores foram observados no pulvinar, assim como a justaposição deles. Isso sugere a preservação da via subcortical Colículo Superior -> Pulvinar -> Amígdala, indicando que, apesar das particularidades evolutivas dos platirrinos, esse circuito de processamento rápido de estímulos visuais aversivos permanece conservado em C. jacchus.


  • Mostrar Abstract
  • Rapid threat detection and reaction are crucial for an individual's survival. Primates possess highly complex visual systems selected throughout their evolutionary history. The Snake Detection Theory (Isbell, 2006) postulates that the primary evolutionary pressure was the coexistence with venomous snakes. One of Isbell's core hypotheses is that platyrrhines would have more varied visual systems compared to catarrhines due to a hiatus in their coexistence with snakes. Inspired by the study by Elorette et al. (2018), we analyzed the movement of neural tracers through the brains of Callithrix jacchus individuals (n=3), infusing a retrograde tracer into the amygdala and an anterograde tracer into the superior colliculus to observe if they converged in the pulvinar, aiming to elucidate the presence of the "low road" of emotional visual processing. Tissues were processed with immunofluorescence and observed using epifluorescence and laser scanning confocal microscopy. Both tracers were observed in the pulvinar, as well as their juxtaposition. This suggests the preservation of the Superior Colliculus -> Pulvinar -> Amygdala subcortical pathway, indicating that, despite the evolutionary particularities of platyrrhines, this rapid processing circuit for aversive visual stimuli remains preserved in C. jacchus.

4
  • VICTÓRIA RAFAELA MUNIZ DOS SANTOS
  • Avaliação da eficácia terapêutica do peptídeo Octovespina em um modelo de Doença de Alzheimer induzido por beta-amiloide.

  • Orientador : LUANA CRISTINA CAMARGO
  • MEMBROS DA BANCA :
  • ANDREIA BIOLCHI MAYER
  • LUANA CRISTINA CAMARGO
  • MARCIA RENATA MORTARI
  • RAFAEL PLAKOUDI SOUTO MAIOR
  • Data: 19/02/2026

  • Mostrar Resumo
  • A Doença de Alzheimer (DA) é uma doença neurodegenerativa progressiva, sendo a principal causa de demência em idosos. A patogênese da DA está associada à hipótese da cascata β-amilóide (βA-42), levando à disfunção sináptica, neuroinflamação e morte neuronal, principalmente em regiões como o hipocampo e córtex cerebral. Apesar dos avanços na compreensão da doença, os tratamentos atuais apresentam grandes limitações. Nesse contexto, compostos derivados de peçonhas animais têm se destacado como fontes promissoras de moléculas bioativas com alta especificidade para alvos do Sistema Nervoso Central. A octovespina, um peptídeo bioinspirado na occidentalina-1202, isolada da peçonha da vespa Polybia occidentalis, demonstrou, em modelos in vivo e in vitro, capacidade de reduzir a agregação de βA-42 e melhorar déficits cognitivos em camundongos. Porém, limitações farmacocinéticas, como baixa biodisponibilidade e dificuldade de atravessar a barreira hematoencefálica restringem sua aplicação clínica. Este projeto propõe a avaliação da octovespina administrada de forma intranasal para facilitar a entrega ao Sistema Nervoso Central, aumentando estabilidade, solubilidade e eficácia terapêutica, avaliando seus efeitos neuroprotetores em camundongos Swiss com modelo experimental de DA induzido por βA-42.


  • Mostrar Abstract
  • Alzheimer’s disease (AD) is a progressive neurodegenerative disorder and the leading cause of dementia in the elderly. The pathogenesis of AD is closely associated with the β-amyloid (Aβ-42) cascade hypothesis, which leads to synaptic dysfunction, neuroinflammation, and neuronal death, particularly in brain regions such as the hippocampus and cerebral cortex. Despite advances in the understanding of the disease, current treatments present major limitations. In this context, compounds derived from animal venoms have emerged as promising sources of bioactive molecules with high specificity for targets in the Central Nervous System. Octovespin, a bioinspired peptide derived from occidentalin-1202, isolated from the venom of the wasp Polybia occidentalis, has demonstrated, in both in vivo and in vitro models, the ability to reduce Aβ-42 aggregation and improve cognitive deficits in mice. However, pharmacokinetic limitations, such as low bioavailability and difficulty in crossing the blood–brain barrier, restrict its clinical application. This project proposes the evaluation of intranasally administered octovespin to facilitate delivery to the Central Nervous System, enhancing stability, solubility, and therapeutic efficacy, and to assess its neuroprotective effects in Swiss mice using an experimental AD model induced by Aβ-42.

5
  • VALÉRIA MIRANDA AMORIM
  • Avaliação comparativa de procedimentos para imputação de mitogenomas para inferência de haplogrupos mitocondriais em populações miscigenadas brasileiras (Kalunga e Brasília)

  • Orientador : SILVIENE FABIANA DE OLIVEIRA
  • MEMBROS DA BANCA :
  • ALINE PIC TAYLOR
  • Celso Teixeira Mendes Junior
  • MARCEL RODRIGUES FERREIRA
  • SILVIENE FABIANA DE OLIVEIRA
  • Data: 25/02/2026

  • Mostrar Resumo
  • A análise do DNA mitocondrial é uma ferramenta crucial na genética de populações, uma vez que sua herança uniparental e elevada variabilidade permitem investigar processos históricos de formação, migração e estruturação populacional. A inferência de haplogrupos mitocondriais é amplamente utilizada na caracterização da diversidade e da estrutura genética, sendo o software HaploGrep uma das abordagens mais atual e eficaz. Contudo, quando baseada em um número reduzido de marcadores, essa inferência pode apresentar baixa confiabilidade, tornando a imputação do mitogenoma uma técnica robusta para ampliar a definição filogenética. Essa técnica, entretanto, depende de painéis de referência nos quais populações miscigenadas, como a brasileira, permanecem sub-representadas. Dessa forma, o objetivo deste estudo foi avaliar o desempenho da imputação de mitogenomas na caracterização da diversidade e estrutura genética materna, por meio da comparação entre duas populações brasileiras com histórias demográficas. Foram analisados 175 indivíduos, sendo 105 da população de Brasília e 70 da comunidade quilombola Kalunga. A inferência inicial dos haplogrupos foi realizada a partir de um conjunto reduzido de SNPs utilizando o HaploGrep, seguida pela imputação do mitogenoma por meio do Beagle 5.4 e do pipeline MitoImpute (Impute2), afim de aprimorar a classificação filogenética e avaliar o desempenho da imputação sobre a qualidade das atribuições. A imputação resultou em um aumento do número de sítios informativos e melhorou na qualidade das inferências dos haplogrupos, com escores médios elevados em ambas as populações. A comparação entre os métodos revelou desempenho semelhante quanto à taxa de atribuição dos haplogrupos, embora o MitoImpute tenha apresentado maior consistência nos escores de qualidade. A análise da composição genética evidenciou predominância de linhagens maternas africanas na comunidade Kalunga, refletindo seu histórico de formação e isolamento relativo, enquanto a população de Brasília apresentou um perfil altamente miscigenado, com maior contribuição europeia, além de componentes africanos e indígenas, e participação minoritária de linhagens asiáticas. As análises de estrutura populacional indicaram diferenciação genética moderada entre as coortes, compatível com suas trajetórias demográficas distintas. Em conjunto, os resultados demonstram que a imputação de mitogenomas é uma técnica robusta e informativa para a caracterização da diversidade e da estrutura genética materna em populações brasileiras, especialmente em cenários de elevada miscigenação e de sub-representação em painéis de referência genômica.


  • Mostrar Abstract
  • Mitochondrial DNA analysis is a cornerstone of population genetics, as its uniparental inheritance and high level of variability enable the investigation of historical processes of population formation, migration, and genetic structure. Mitochondrial haplogroup inference is widely used to characterize genetic diversity and population structure, with HaploGrep being among the most widely adopted and reliable tools. However, when inference is based on a limited number of markers, haplogroup assignment may be unreliable, making mitogenome imputation a robust strategy for improving phylogenetic definition. This approach, however, relies on reference panels in which admixed populations—such as Brazilians—remain underrepresented. Accordingly, this study aimed to evaluate the performance of mitogenome imputation in characterizing maternal genetic diversity and population structure by comparing two Brazilian cohorts with contrasting demographic histories. A total of 175 individuals were analyzed, including 105 from the urban population of Brasília and 70 from the Kalunga quilombola community. Initial haplogroup inference was conducted using a reduced set of mitochondrial SNPs in HaploGrep, followed by mitogenome imputation using Beagle 5.4 and the MitoImpute pipeline (Impute2), with the goal of refining phylogenetic classification and assessing the impact of imputation on assignment quality. Imputation substantially increased the number of informative sites and improved haplogroup assignment quality, yielding high mean scores in both populations. Method comparisons showed similar haplogroup assignment rates; however, MitoImpute exhibited great er consistency in quality scores. Analysis of maternal genetic composition revealed a predominance of African lineages in the Kalunga community, consistent with its historical formation and relative isolation. In contrast, the Brasília population displayed a highly admixed profile, with a stronger European contribution alongside African and Indigenous components, as well as a minor representation of Asian lineages. Population structure analyses indicated moderate genetic differentiation between cohorts, in line with their distinct demographic trajectories. Taken together, these findings demonstrate that mitogenome imputation is a robust and informative approach for characterizing maternal genetic diversity and population structure in Brazilian populations, particularly in settings characterized by high admixture and underrepresentation in genomic reference panels.

6
  • Guilherme Antônio Dias Carvalho
  • "Avaliação dos Efeitos Antidepressivos da Ayahuasca em um Modelo Animal de Depressão Induzida por LPS: Estudo Comparativo de Ayahuasca, DMT e Fluoxetina em Ratos Wistar utilizando o Teste Comportamental do Campo Aberto."

  • Orientador : DANIELA MARA DE OLIVEIRA
  • MEMBROS DA BANCA :
  • DANIELA MARA DE OLIVEIRA
  • ALINE PIC TAYLOR
  • FERNANDA PAULINI
  • BEATRIZ WERNECK LOPES SANTOS
  • Data: 02/03/2026

  • Mostrar Resumo
  • Transtorno Depressivo Maior é uma doença dinâmica que pode assumir várias formas nos indivíduos e é mais do que apenas tristeza e anedonia. Embora o tratamento farmacoterapêutico da depressão possa ser uma estratégia complexa, muitos pacientes não respondem às terapias padrão, seja pela falta de benefício ou pelos efeitos colaterais dolorosos que surgem.Ayahuasca é uma bebida da bacia amazônica, composta principalmente pela videira Banisteriopsis caapi e pelas folhas do arbusto Psychotria viridis. Esses alcaloides, em particular a dimetiltriptamina (DMT), a harmina e a harmalina, são fundamentais para sua ação antidepressiva. No total, 126 ratos foram divididos aleatoriamente em vários grupos: ayahuasca (três doses diferentes), DMT, um controle negativo com solução salina, controle depressivo induzido por LPS e um grupo controle positivo que recebeu o antidepressivo fluoxetina. A pesquisa buscou investigar a atividade antidepressiva da ayahuasca em várias concentrações e da DMT isoladamente, em relação às propriedades antidepressivas de um composto padrão (fluoxetina). LPS, o indutor depressivo, foi administrado a cada dois dias após 15 dias, e cada um recebeu uma administração diária da respectiva substância. Animais que receberam ayahuasca mostraram aumento da capacidade locomotora no teste de campo aberto, tanto no centro do campo aberto quanto nos quadrantes, indicando que tratamento com ayahuasca melhorou o comportamento relacionado à depressão. Esta observação indica o aumento da atividade exploratória devido ao aumento da busca por novidades e aumento da reatividade a estímulos, sem o desenvolvimento de fobia a espaços abertos. A administração isolada de DMT não produziu o mesmo efeito. Por fim, a possibilidade de ayahuasca, pelo menos para combater um estado depressivo, deve ser examinada mais profundamente com abordagens comportamentais adicionais e mais numerosas avaliações bioquímicas.


  • Mostrar Abstract
  • Major Depressive Disorder is a complex mental illness that manifests in different ways amongst different people, beyond just feelings of sadness and anhedonia. Pharmacotherapeutic depression treatment can be a careful endeavor, as many patients fail traditional therapies due to no benefit or pain. Ayahuasca is a brew from the Amazon basin made up primarily of the vine Banisteriopsis caapi and the leaves of the shrub Psychotria viridis. The alkaloids, including Dimethyltryptamine (DMT), harmine, and harmaline, are responsible for its antidepressant effect. An "N" of 126 rats were randomized into several groups (3 different doses of ayahuasca, DMT, a negative saline control, an LPS-induced depression control, and a positive control receiving the antidepressant fluoxetine). The study intended to evaluate the antidepressant activity of ayahuasca at different concentrations, as well as DMT alone versus the antidepressant effects of a standardized substance - fluoxetine. After 15 days, the animals received the depressant inducer lipopolysaccharides every second day, while each animal received daily administration of the respective substance. Ayahuasca treatment improved depressionrelated behavior, as animals given ayahuasca showed increased locomotor ability in the center and quadrants of the open field test, consistent with enhanced active exploratory behavior from greater environmental interest and increased response to stimuli without a phobia of open spaces. The same effect was not seen with isolated DMT administration. Ayahuasca's potential for, at least, combating a depressive state should be further explored with more behavioral approaches and more extensive biochemistry evaluations.

7
  • ANA BEATRIZ NOGUEIRA PACHECO
  • "Bioatividade de extratos brutos e frações cromatográficas de algas marrons antárticas (Desmarestia spp.) com ênfase nas atividades antitumoral e antimicrobiana."

  • Orientador : FERNANDA PAULINI
  • MEMBROS DA BANCA :
  • FERNANDA PAULINI
  • PAULA MARIA QUAGLIO BELLOZI
  • GIOVANNA BARBARINI LONGATO
  • DANIEL CARNEIRO MOREIRA
  • Data: 17/03/2026

  • Mostrar Resumo
  • A resistência microbiana aos antibióticos e o câncer configuram-se como dois dos principais desafios da saúde pública global. O aumento de cepas multirresistentes dificulta o controle de infecções, especialmente em contextos clínicos complexos. Paralelamente, o câncer permanece entre as principais causas de mortalidade mundial, sendo responsável por milhões de óbitos anuais. Embora tratamentos como quimioterapia e radioterapia sejam amplamente empregados, esses métodos apresentam caráter inespecífico, elevados efeitos colaterais, incluindo efeitos adversos sobre a fertilidade. Nesse cenário, a prospecção de compostos bioativos de origem natural emerge como estratégia promissora para o desenvolvimento de terapias menos invasivas e mais seletivas. As algas marinhas destacam-se como fonte relevante de metabólitos secundários com atividades antioxidante, antitumoral e antimicrobiana. Entre elas, as algas pardas do gênero Desmarestia, amplamente distribuídas em regiões frias do hemisfério sul e predominantes na Antártida, apresentam potencial biotecnológico associado às condições ambientais extremas às quais estão adaptadas. Diante disso, o presente estudo teve como objetivo avaliar a atividade antiproliferativa e antimicrobiana de extratos brutos diluídos e frações obtidas por cromatografia líquida de alta eficiência (HPLC) de espécies do gênero Desmarestia coletadas na Antártida. A atividade antitumoral foi investigada por meio de ensaios in vitro utilizando as linhagens celulares humanas A2780 (câncer de ovário) e MCF7 (câncer de mama). Paralelamente, os extratos foram avaliados quanto ao seu potencial antimicrobiano, considerando o contexto crescente de resistência a fármacos convencionais. Assim, busca-se contribuir para o desenvolvimento de novas abordagens terapêuticas com potencial aplicação tanto no tratamento do câncer quanto no combate a infecções causadas por microrganismos resistentes.


  • Mostrar Abstract
  • Antibiotic resistance and cancer represent two of the most pressing global public health challenges. The increasing prevalence of multidrug-resistant strains has made infection control particularly difficult, especially in complex clinical settings. At the same time, cancer remains one of the leading causes of mortality worldwide, accounting for millions of deaths each year. Although chemotherapy and radiotherapy are widely used, these treatments are often nonspecific and associated with significant adverse effects, including detrimental impacts on fertility. In this context, the investigation of natural bioactive compounds has emerged as a promising strategy for the development of more selective and less invasive therapeutic approaches. Marine algae are recognized as an important source of secondary metabolites exhibiting antioxidant, antitumor, and antimicrobial activities. Among them, brown algae of the genus Desmarestia, widely distributed in cold regions of the Southern Hemisphere and particularly abundant in Antarctica, demonstrate considerable biotechnological potential due to their adaptation to extreme environmental conditions. Therefore, this study aimed to evaluate the antiproliferative and antimicrobial activities of diluted crude extracts and fractions obtained by high-performance liquid chromatography (HPLC) from Desmarestia species collected in Antarctica. Antitumor activity was assessed through in vitro assays using the human cell lines A2780 (ovarian cancer) and MCF7 (breast cancer). In parallel, the extracts were evaluated for their antimicrobial potential in light of the growing concern over resistance to conventional drugs. Overall, this study seeks to contribute to the development of novel therapeutic strategies with potential applications in both cancer treatment and the management of infections caused by resistant microorganisms.

Teses
1
  • Tathyana Benetis Piau
  • "Nanopartículas Lipídicas Sólidas com curcumina (NLS-Cur) associadas ou não com fatores de crescimento (BMP15 e GDF9): caracterização e aplicação em diferentes contextos da reprodução".

  • Orientador : FERNANDA PAULINI
  • MEMBROS DA BANCA :
  • FERNANDA PAULINI
  • JOÃO HENRIQUE MOREIRA VIANA
  • MONICA PEREIRA GARCIA
  • Maria de Sousa Brito Neta
  • PAULO HENRIQUE DE ALMEIDA CAMPOS JÚNIOR
  • Data: 14/01/2026

  • Mostrar Resumo
  • A preservação de germoplasma em canídeos enfrenta desafios relacionados à instabilidade dos fatores de crescimento in vitro e à complexidade da manutenção da foliculogênese ex vivo. Nesse contexto, a presente tese integra a compreensão teórica da sinalização ovariana, detalhando o papel crítico do sistema Insulin-like Growth Factor (IGF) na competência oocitária, ao desenvolvimento experimental de uma plataforma nanobiotecnológica para auxiliar na preservação da fertilidade. A etapa experimental consistiu na engenharia de Nanopartículas Sólidas Lipídicas carregadas com Curcumina (SLN-Cur), utilizando solventes eutéticos naturais (NaDES). A caracterização físico-química confirmou partículas estáveis (~50 nm) e os ensaios em modelos de trofoblastos (BeWO e HTR8/SVneo) e zebrafish (Danio rerio) demonstraram alta biocompatibilidade e capacidade de modulação imuno-redox contexto-dependente. Na avaliação funcional em células do cumulus canino, a SLN-Cur atuou não apenas como veículo, mas como agente bioativo, prevenindo a luteinização precoce através da supressão da expressão gênica de StAR. Além disso, a nanoencapsulação dos fatores de crescimento GDF9 e BMP15 preservou a comunicação celular, mantendo níveis superiores de CX43 (junções comunicantes) em comparação aos fatores livres. Por fim, a eficácia do sistema foi testada no xenotransplante de tecido ovariano de cadelas criopreservado. A criopreservação manteve a integridade da reserva ovariana (67,8% de folículos morfologicamente normais - MN). O uso da nanotecnologia no transplante revelou respostas distintas: enquanto o veículo (NLS-Cur) garantiu a segurança da reserva primordial (88,6% MN), a associação com fatores específicos ditou o destino folicular. O tratamento com NLS-Cur-B15 promoveu ativação folicular massiva com manutenção da qualidade (81,4% MN nos folículos em crescimento), revertendo a degeneração observada no veículo. Em contraste, o NLS-Cur-G9 estimulou o crescimento, mas falhou em sustentar a viabilidade (40% MN), e a combinação dos fatores mostrou-se deletéria. Conclui-se que a plataforma SLN-Cur representa uma ferramenta promissora para bancos de germoplasma, permitindo a liberação controlada de fatores que modulam desde a expressão gênica em células somáticas até a dinâmica e qualidade folicular em tecido transplantado.


  • Mostrar Abstract
  • Germplasm preservation in canids faces challenges regarding the instability of growth factors in vitro and the complexity of maintaining folliculogenesis ex vivo. In this context, this thesis integrates the theoretical understanding of ovarian signaling, detailing the critical role of the Insulin-like Growth Factor (IGF) system in oocyte competence, with the experimental development of a nanobiotechnological platform to aid in fertility preservation. The experimental stage consisted of engineering Curcumin-loaded Solid Lipid Nanoparticles (SLN-Cur) using natural deep eutectic solvents (NaDES). Physicochemical characterization confirmed stable particles (~50 nm), and assays in trophoblast (BeWo and HTR8/SVneo) and zebrafish (Danio rerio) models demonstrated high biocompatibility and context-dependent immuno-redox modulation capacity. In the functional evaluation in canine cumulus cells, SLN-Cur acted not only as a vehicle but also as a bioactive agent, preventing premature luteinization through the suppression of StAR gene expression. Furthermore, the nanoencapsulation of growth factors GDF9 and BMP15 preserved cell communication, maintaining higher levels of CX43 (gap junctions) compared to free factors. Finally, the system's efficacy was tested in the xenotransplantation of cryopreserved canine ovarian tissue. Cryopreservation maintained the integrity of the ovarian reserve (67.8% morphologically normal follicles - MN). The use of nanotechnology in transplantation revealed distinct responses: while the vehicle (SLN-Cur) ensured the safety of the primordial reserve (88.6% MN), the association with specific factors dictated the follicular fate. Treatment with SLN-Cur-B15 promoted massive follicular activation with quality maintenance (81.4% MN in growing follicles), reversing the degeneration observed in the vehicle group. In contrast, SLN-Cur-G9 stimulated growth but failed to sustain viability (40% MN), and the combination of factors proved to be deleterious. It is concluded that the SLN-Cur platform represents a promising tool for germplasm banks, allowing the controlled release of factors that modulate from gene expression in somatic cells to follicular dynamics and quality in transplanted tissue.

2
  • INGRID GRACIELLE MARTINS DA SILVA
  • "Morfologia comparada das terminálias masculinas e da ultraestrutura do espermatozóide de Syrphidae (Diptera, Brachycera)."

  • Orientador : SONIA NAIR BAO
  • MEMBROS DA BANCA :
  • JOSE ROBERTO PUJOL LUZ
  • LUIZ ANTONIO LIRA JÚNIOR
  • MARINA REGINA FRIZZAS
  • SARAH SIQUEIRA DE OLIVEIRA
  • SONIA NAIR BAO
  • Data: 08/04/2026

  • Mostrar Resumo
  • O estudo teve como objetivo caracterizar a morfologia das terminálias masculinas de moscas da família Syrphidae; trata-se de um grupo que apresenta grande diversidade e importância ecológica, pois além de serem polinizadoras são também indicadoras ambientais e de degradação. O grupo apresenta desafios na identificação de suas espécies devido à variabilidade morfológica, em razão disso, as terminálias masculinas, estruturas genitais dos machos, são frequentemente utilizadas em estudos taxonômicos e filogenéticos. Por meio da análise detalhada da morfologia das terminálias, utilizando as técnicas de microscopia eletrônica de varredura e transmissão, além da microscopia confocal, buscamos contribuir para o conhecimento taxonômico do grupo e fornecer dados para estudos comparativos. Além disso, investigamos a ultraestrutura do espermatozóide em espécimes preservados em álcool 70%, visando avaliar a viabilidade da utilização desse material para estudos morfológicos. Os resultados obtidos neste estudo mostraram uma grande diversidade morfológica das terminálias, com características ultraestruturais importantes, como presença de pelos, tamanho e formato das estruturas; que diferem visivelmente entre as espécies de subfamílias diferentes. Ademais, a caracterização ultraestrutural do espermatozóide das espécies forneceu dados que contribuem para ampliar a base de dados morfológicos disponíveis sobre as espécies do grupo.


  • Mostrar Abstract
  • The study aimed to characterize the morphology of the male genitalia of flies in the Syrphidae family; this is a group that exhibits great diversity and ecological importance, as these flies are not only pollinators but also serve as environmental indicators and indicators of degradation. The group presents challenges in the identification of its species due to morphological variability; for this reason, male terminalia, the genital structures of males, are frequently used in taxonomic and phylogenetic studies. Through a detailed analysis of terminalia morphology, using scanning and transmission electron microscopy techniques, as well as confocal microscopy, we aim to contribute to the taxonomic understanding of the group and provide data for comparative studies. In addition, we investigated the ultrastructure of spermatozoa in specimens preserved in 70% alcohol, aiming to evaluate the feasibility of using this material for morphological studies. The results obtained in this study showed a high morphological diversity of the terminal structures, with important ultrastructural characteristics, such as the presence of hairs, and the size and shape of the structures; these differ visibly among species of different subfamilies. Furthermore, the ultrastructural characterization of the spermatozoa of the species provided data that contributes to expanding the available morphological database on the species of the group.

2025
Dissertações
1
  • ISABELLA RODRIGUES DOS SANTOS OLIVEIRA
  • "Efeito da suplementação com melatonina no meio de cultivo de embriões bovinos produzidos in vitro em sistemas de alta e baixa tensão de oxigênio."

  • Orientador : SONIA NAIR BAO
  • MEMBROS DA BANCA :
  • ALEXANDRE FLORIANI RAMOS
  • IVO PIVATO
  • RAFAEL GIANELLA MONDADORI
  • SONIA NAIR BAO
  • Data: 20/03/2025

  • Mostrar Resumo
  • A melatonina pode promover diversos benefícios para os embriões bovinos em cultivo in vitro, incluindo efeitos anti-apoptóticos, modulação da expressão gênica e redução da produção de espécies reativas de oxigênio (O2). Neste contexto, este estudo avaliou o efeito da suplementação com de melatonina a 10-9M no meio de cultivo in vitro de embriões bovinos sob diferentes tensões de oxigênio (alta - 20% e baixa - 5%). Os zigotos produzidos por fecundação in vitro com sêmen de touro com fertilidade conhecida no laboratório foram distribuídos em quatro grupos experimentais: alta tensão de O2 com e sem melatonina e baixa tensão de O2 com e sem melatonina. A taxa de blastocisto, nível de expressão gênica, metabolismo lipídico e funcionalidade mitocondrial foram mensuradas para identificar o efeito da melatonina nos sistemas de cultivo embrionário e analisadas estatisticamente pelo teste quiquadrado e teste t dentro de cada sistema, com 5% de probabilidade. Os resultados indicaram que a suplementação com melatonina em alta tensão de O2 promoveu aumento significativo na taxa de blastocistos (39,80% vs. 34,04% para os tratamentos com e sem melatonina, respectivamente; p<0,05). Em baixa tensão de O2, não houve diferença na produção de blastocistos (31,67% vs. 31,39% para os tratamentos com e sem melatonina, respectivamente; p>0,05). A análise da expressão gênica revelou que, em alta tensão de O2, o uso da melatonina gerou uma maior expressão dos genes SOD1 (p=0,0022), SOD2 (p=0,0004), PLAC8 (p=0,0392), IFN-τ (p=0,0149) e KRT8 (p<0,0001), sugerindo um efeito protetor contra o estresse oxidativo e melhoria na qualidade embrionária. Em baixa tensão de oxigênio, a melatonina promoveu aumento na expressão de SOD1 (p = 0,0120), enquanto PLAC8 (p = 0,0011) e IFN-τ (p = 0,0061) foram mais expressos no grupo sem melatonina. A avaliação da funcionalidade mitocondrial demonstrou que a suplementação com melatonina aumentou a atividade mitocondrial tanto em alta (p=0,0001) quanto em baixa tensão de O2 (p=0,0001). Além disso, a melatonina reduziu significativamente o acúmulo lipídico nos embriões cultivados sob alta tensão de O2 (p=0,0001), mas não apresentou o mesmo efeito em baixa tensão de O2 (p>0,05). De acordo com os resultados obtidos, conclui-se que a melatonina apresenta uma importante ação antioxidante, sendo eficaz para a otimização do cultivo embrionário em condições de alta tensão de O2. Além disso, ela possui uma discreta ação no sistema com baixa tensão de O2, pois o estresse oxidativo parece ser menos pronunciado nesse ambiente, levando a uma menor necessidade de ativação de mecanismos compensatórios. Desta forma, o uso da melatonina é importante para os sistemas de produção in vitro de embriões bovinos.


  • Mostrar Abstract
  • Melatonin can promote several benefits for bovine embryos in in vitro culture, including antiapoptotic effects, modulation of gene expression and reduction of reactive oxygen species (O2) production. In this context, this study evaluated the effect of melatonin supplementation at 10-9 M in the in vitro culture medium of bovine embryos under different oxygen tensions (high - 20% and low - 5%). The zygotes produced by in vitro fertilization with semen from bulls with known fertility in the laboratory were distributed into four experimental groups: high O2 tension with and without melatonin and low O2 tension with and without melatonin. Blastocyst rate, gene expression level, lipid metabolism and mitochondrial functionality were measured to identify the effect of melatonin on embryo culture systems and statistically analyzed using the chi-square test and t-test within each system, with a 5% probability. The results indicated that melatonin supplementation at high O2 tension promoted a significant increase in the blastocyst rate (39.80% vs. 34.04% for the treatments with and without melatonin, respectively; p<0.05). At low O2 tension, there was no difference in blastocyst production (31.67% vs. 31.39% for treatments with and without melatonin, respectively; p>0.05). Analysis of gene expression revealed that, at high O2 tension, the use of melatonin generated greater expression of the genes SOD1 (p=0.0022), SOD2 (p=0.0004), PLAC8 (p=0.0392), IFN-τ (p=0.0149) and KRT8 (p<0.0001), suggesting a protective effect against oxidative stress and improved embryonic quality. At low oxygen tension, melatonin promoted an increase in the expression of SOD1 (p = 0.0120), while PLAC8 (p = 0.0011) and IFN-τ (p = 0.0061) were more expressed in the group without melatonin. Evaluation of mitochondrial functionality showed that melatonin supplementation increased mitochondrial activity both at high (p = 0.0001) and low O2 tension (p = 0.0001). In addition, melatonin significantly reduced lipid accumulation in embryos cultured under high O2 tension (p=0.0001), but did not show the same effect at low O2 tension (p>0.05). According to the results obtained, it can be concluded that melatonin has an important antioxidant action and is effective in optimizing embryo cultivation under conditions of high O2 tension. In addition, it has a discreet action in the system with low O2 tension, as oxidative stress seems to be less pronounced in this environment, leading to less need to activate compensatory mechanisms. In this way, the use of melatonin is important for in vitro bovine embryo production systems.

2
  • ANA CECILIA RICARTE DOS SANTOS
  • Aplicação de fotohipertermia testicular mediada por nanopartículas para indução de infertilidade em gatos

  • Orientador : CAROLINA MADEIRA LUCCI
  • MEMBROS DA BANCA :
  • CAROLINA MADEIRA LUCCI
  • CHRISTINE SOUZA MARTINS
  • MONICA PEREIRA GARCIA
  • SUELIA DE SIQUEIRA RODRIGUES FLEURY ROSA
  • Data: 30/04/2025

  • Mostrar Resumo
  • O objetivo do trabalho foi avaliar o efeito da fotohipertemia mediada por nanopartículas (FHT) aplicada diretamente aos testículos, como método de castração alternativo em gatos, bem como validar o protocolo de anestesia para o procedimento. Gatos machos adultos foram submetidos à FHT testicular e divididos em três grupos, de acordo com o dia da orquiectomia pós-FHT, a saber: sete dias (G7); 28 dias (G28) e 49 dias (G49). Após o FHT, os pacientes foram avaliados quanto a dor e aspectos testiculares macroscópicos e ultrassonográficos. No dia da castração os testículos e epidídimos foram coletados e preparados para análise histopatológica. Os pacientes permaneceram sem dor durante todo o período do experimento com administração de meloxicam e dipirona apenas no dia do procedimento de FHT. Nenhum animal apresentava espermatozoides nos epidídimos no dia da orquiectomia. A avaliação histológica dos testículos mostrou degeneração progressiva, com maior infiltrado inflamatório em G7, que foi desaparecendo no G28 e G49, dando espaço a áreas necróticas. Ainda são necessários mais estudos para avaliar os efeitos do FHT à longo prazo. 


  • Mostrar Abstract
  • The aim of this study was to evaluate the eƯect of nanoparticle-mediated photohypertemia (NMPH) applied directly to the testicles as an alternative castration method for cats, as well as to validate the anesthesia protocol for the procedure. Adult male cats underwent testicular NMPH and were divided into three groups according to the day of post- NMPH orchiectomy, namely: seven days (G7); 28 days (G28) and 49 days (G49). After NMPH, patients were evaluated for pain and macroscopic and ultrasonographic testicular aspects. On the day of castration, the testicles and epididymis were collected and prepared for histopathological analysis. Patients remained pain-free during the experimental period with administration of a single dose of meloxicam and dipyrone on the day of the procedure. No animal had sperm in the epididymis after orchiectomy. Histological evaluation of the testicles showed progressive degeneration, with greater inflammatory infiltrate in G7, which disappeared in G28 and G49, being replaced by necrotic areas. Further studies are still needed to evaluate the long-term eƯects of FHT.

3
  • Romany Louise Ribeiro Gonçalves
  • “Caracterização de sequelas subsequentes a aspiração folicular e efeitos do tratamento com células tronco mesenquimais e vesículas extracelulares sobre a população folicular ovariana em bovinos”.

  • Orientador : JOÃO HENRIQUE MOREIRA VIANA
  • MEMBROS DA BANCA :
  • JOÃO HENRIQUE MOREIRA VIANA
  • CAROLINA MADEIRA LUCCI
  • PAULO HENRIQUE DE ALMEIDA CAMPOS JÚNIOR
  • RICARDO ALAMINO FIGUEIREDO
  • Data: 29/05/2025

  • Mostrar Resumo
  • A produção in vitro de embriões (PIVE) revolucionou a reprodução animal, representando uma ferramenta essencial para o avanço genético dos rebanhos. Seu desenvolvimento está diretamente associado à técnica de aspiração folicular transvaginal guiada por ultrassonografia (OPU), amplamente utilizada em programas de coleta de oócitos. No entanto, a repetição frequente desse procedimento pode provocar danos ao tecido ovariano, em função dos múltiplos traumas causados pela agulha de aspiração. Esse efeito cumulativo pode comprometer a função ovariana, sobretudo em fêmeas submetidas a protocolos intensivos de aspiração. Nas rotinas comerciais, a pressão por resultados tem intensificado o uso de doadoras, levando ao descarte precoce de fêmeas com alto valor genético devido a patologias ovarianas associadas à OPU. Nesse contexto, estudos experimentais com modelos animais indicam que o uso terapêutico de células-tronco mesenquimais (CTM) e vesículasextracelulares (VE) pode contribuir para a recuperação da função ovariana em casos de lesão induzida. Este estudo teve como objetivo avaliar os danos clínicos e histopatológicos causados pela OPU nos ovários de doadoras bovinas submetidas a sucessivas OPU, bem como investigar o potencial efeito terapêutico das CTM e VECTM sobre as características histológicas ovarianas. No primeiro estudo foram avaliadas as consequências clínicas e histopatológicas observadas no ovário de vacas da raça Gir submetidas a sessões repetidas de OPU. Foram realizadas avaliações ultrassonográficas dos ovários e útero, dosagens plasmáticas de hormônio antiMülleriano (AMH) e análises macro e microscópicas dos ovários. No segundo estudo foram avaliados histologicamente ovários de vacas da raça Nelore submetidas à OPU, previamente utilizadas em estudo para análise do efeito in vivo da aplicação intraovariana de CTM ou VE-CTM. As doadoras foram distribuídas aleatoriamente em quatro grupos experimentais: controle (solução salina 0,9%), CTM, VE-CTM e hidrogel (veículo). As análises histológicas incluíram avaliação da densidade folicular (folículos primordiais, primários e secundários), da espessura da túnica albugínea e da proporção volumétrica dos componentes teciduais (tecido conjuntivo, folículos, tecido luteal e vasos sanguíneos). No primeiro estudo observou-se que o número de sessões de OPU esteve negativamente correlacionado com a recuperação de oócitos, sua viabilidade e a produção embrionária (P<0,01). Clinicamente, 91,7% das doadoras apresentaram doença cística ovariana e 83,3% tinham mucometra. Alterações xi macroscópicas, como aderências, foram identificadas em 16,7% dos ovários. Histologicamente, todos os ovários analisados exibiram graus variáveis de enrijecimento e deposição de colágeno, sendo essas alterações intensas em 82% dos casos. O segundo estudo, constatou que a aplicação de CTM e VE-CTM não resultou em diferenças significativas na densidade de folículos primordiais e primários entre os grupos. Contudo, o grupo tratado com hidrogel apresentou maior densidade de folículos secundários em comparação ao controle (P<0,05). As proporções volumétricas de tecido conjuntivo, folículos, tecido luteal e vasos sanguíneos, bem como a espessura da túnica albugínea, não diferiram significativamente entre os grupos. Os achados do primeiro estudo indicam que a realização frequente de OPU pode comprometer progressivamente a função reprodutiva em vacas Gir, destacando a importância de estratégias de manejo que visem preservar a saúde reprodutiva e a longevidade produtiva dessas doadoras. Em vacas doadoras de oócitos a aplicação intraovariana de CTM e VE-CTM é uma técnica segura, sem aparentes impactos negativos sobre os ovários e sua composição tecidual.


  • Mostrar Abstract
  • In vitro embryo production (IVEP) has revolutionized animal reproduction, representing an essential tool for the genetic improvement of herds. Its development is directly associated with the technique of transvaginal ultrasound-guided follicular aspiration (OPU), which is widely used in oocyte collection programs. However, the frequent repetition of this procedure can cause damage to ovarian tissue due to multiple traumas caused by the aspiration needle. This cumulative effect may impair ovarian function, especially in females subjected to intensive aspiration protocols. In commercial settings, the pressure for results has intensified the use of donors, leading to the early culling of genetically valuable females due to ovarian pathologies associated with OPU. In this context, experimental studies using animal models indicate that the therapeutic use of mesenchymal stem cells (MSCs) and MSC-derived extracellular vesicles (MSC-EVs) may contribute to the recovery of ovarian function in cases of induced injury. This study aimed to evaluate the clinical and histopathological damage caused by OPU in the ovaries of bovine donors subjected to successive OPU sessions, as well as to investigate the potential therapeutic effect of MSCs and MSC-EVs on ovarian histological characteristics. In the first study, clinical and histopathological consequences were assessed in the ovaries of Gir cows subjected to repeated OPU sessions. Ultrasonographic evaluations of the ovaries and uterus, plasma anti-Müllerian hormone (AMH) levels, and macro- and microscopic analyses of the ovaries were conducted. In the second study, ovaries of Nelore cows previously used in an in vivo study on the effect of intraovarian application of MSCs or MSC-EVs were histologically evaluated. Donors were randomly assigned to four experimental groups: control (0.9% saline solution), MSCs, MSC-EVs, and hydrogel (vehicle). Histological analyses included the assessment of follicular density (primordial, primary, and secondary follicles), tunica albuginea thickness, and the volumetric proportion of tissue components (connective tissue, follicles, luteal tissue, and blood vessels). In the first study, it was observed that the number of OPU sessions was negatively correlated with oocyte recovery, viability, and embryo production (P < 0.01). Clinically, 91.7% of the donors presented with ovarian cystic disease, and 83.3% had mucometra. Macroscopic alterations such as adhesions were identified in 16.7% of the ovaries. Histologically, all analyzed ovaries showed varying degrees of hardening and collagen deposition, with severe changes observed in 82% of cases. In the second study, the application of MSCs xiii and MSC-EVs did not result in significant differences in the density of primordial and primary follicles among groups. However, the group treated with hydrogel showed a higher density of secondary follicles compared to the control group (P < 0.05). The volumetric proportions of connective tissue, follicles, luteal tissue, and blood vessels, as well as the thickness of the tunica albuginea, did not differ significantly among the groups. The findings of the first study indicate that frequent OPU procedures may progressively impair reproductive function in Gir cows, highlighting the importance of management strategies aimed at preserving reproductive health and productive longevity in these donors. In oocyte donor cows, intraovarian application of MSCs and MSC-EVs is a safe technique with no apparent negative impact on the ovaries and their tissue composition.

4
  • KARINA FIGUEIREDO HENRIQUES
  • Variantes gênicas raras em pacientes do sexo feminino (46,XX) que apresentam deficiência intelectual sindrômica

  • Orientador : SILVIENE FABIANA DE OLIVEIRA
  • MEMBROS DA BANCA :
  • ALINE PIC TAYLOR
  • RINALDO WELLERSON PEREIRA
  • ROLANDO ANDRE RIOS VILLACIS
  • SILVIENE FABIANA DE OLIVEIRA
  • Data: 10/07/2025

  • Mostrar Resumo
  • A deficiência intelectual (DI) é uma desordem do desenvolvimento que gera limitações em habilidades mentais, funções intelectuais, comportamento adaptativo e habilidades motoras em pessoas afetadas pelo quadro, seja ela sindrômica ou não. A etiologia da DI é extensa e heterogênea, englobando fatores ambientais pré-natais, fatores perinatais e pós-natais, alterações cromossômicas, mutações em um único gene ou múltiplos, entre outras causas. Apesar da utilização de metodologias de citogenética clássica e molecular, e do surgimento e uso do sequenciamento de nova geração (NGS) na investigação da DI, a maioria das pessoas afetadas por essa deficiência ainda não possuem determinada a causa do seu quadro. Inserido nesse contexto, o presente projeto visou investigar e aumentar o entendimento da deficiência intelectual sindrômica em pessoas com cariótipo 46,XX. Nesse sentido, foram selecionadas 15 pacientes acompanhadas pela equipe médica do ambulatório de genética do Hospital Universitário de Brasília (HUB). A busca pela etiologia genética da DI sindrômica dessas pacientes foi feita por meio da utilização da metodologia de sequenciamento completo de exoma (WES), utilizadas de maneira promissora na pesquisa de doenças raras e de DI. No total, foi sequenciado e analisado o exoma de 15 pacientes, sendo que em somente 7/15 dos casos houve o diagnóstico molecular para a etiologia da deficiência intelectual sindrômica. Dos sete casos que tiveram diagnóstico, dois se destacam, uma vez que foram encontradas variantes patogênicas não relatadas previamente. Nos casos que se destacaram, encontrou-se a variante c.1318T>C no gene NARS, causadora do Transtorno de Neurodesenvolvimento com Microcefalia, Prejuízo da Linguagem, Epilepsia e Anormalidades da Marcha; e as variantes c.550G>A e c.1553C>G, encontradas no gene PIGT, causadoras da Síndrome de Múltiplas Anomalias Congênitas-Hipotonia-Convulsões.


  • Mostrar Abstract
  • Intellectual disability (ID) is a developmental disorder that causes limitations in mental abilities, intellectual functions, adaptive behavior, and motor skills in affected individuals, whether the condition is syndromic or not. The causes of ID are broad and diverse, including prenatal environmental factors, perinatal and postnatal factors, chromosomal changes, mutations in one or more genes, and other reasons. Despite using traditional and molecular cytogenetic methods, as well as the emergence of next-generation sequencing (NGS) in ID research, the cause of the condition remains unknown for most individuals. In this context, this project aimed to explore and deepen the understanding of syndromic intellectual disability in women. Fifteen patients, under the care of the genetics outpatient clinic at Hospital Universitário de Brasília (HUB) were selected. The genetic causes of syndromic ID in these patients were investigated using whole exome sequencing (WES), which is a promising method for studying rare diseases and ID. The exomes of all fifteen patients were sequenced and analyzed, resulting in a molecular diagnosis for seven cases. Of these, two cases are particularly noteworthy because they involved pathogenic variants not previously reported. These included the c.1318T>C variant in the NARS gene, that causes the Neurodevelopmental Disorder with Microcephaly, Language Impairment, Epilepsy and Gait Abnormalities; and c.550G>A and c.1553C>G variants, found in the PIGT gene, linked to Multiple Congenital Anomalies-Hypotonia-Seizures Syndrome.

5
  • ALINE KONIG
  • Geração e caracterização fenotípica de mutante para o gene de histona desacetilase HOS2 de Cryptococcus neoformans obtido pela técnica de CRISPR-Cas9 suicida.

  • Orientador : MARCIO JOSE POCAS FONSECA
  • MEMBROS DA BANCA :
  • MARCIO JOSE POCAS FONSECA
  • MAURÍCIO MACHAIM FRANCO
  • ROLANDO ANDRE RIOS VILLACIS
  • ROSANA TIDON
  • Data: 24/07/2025

  • Mostrar Resumo
  • Por meio da técnica de CRISPR-Cas9 suicida, obteve-se mutante para o gene de histona desacetilase Hos2de Cryptococcus neoformans, tipo de acasalamento α. Tal mutante apresentou alterações fenotípicas quanto a fatores de virulência: retardo na curva de crescimento, diminuição da atividade de urease e reduzida termotolerância. Durante cruzamento sexual com mutante previamente obtido no tipo de acasalamento “a”, verificou-se que as hifas de acasalamento se apresentaram mais delgadas, em relação aos cruzamentos controles, e que não houve formação de basídios ou de cadeia de esporos. Esses dados indicam que o gene HOS2 é essencial à compleição do ciclo sexual em C. neoformans, relato pioneiro nesse fungo no tocante a genes relacionados à modificação de histonas.


  • Mostrar Abstract
  • Using the CRISPR-Cas9 suicide technique, a mutant for the histone deacetylase Hos2 gene of Cryptococcus neoformans, mating type α, was obtained. This mutant presented phenotypic alterations in virulence factors: delayed growth curve, decreased urease activity, and reduced thermotolerance. During sexual crossings with a mutant previously obtained in mating type “a”, it was found that the mating hyphae were thinner when compared to the control crosses, and there was no formation of basidia or spore chains. These data indicate that the HOS2 gene is essential for the completion of the sexual cycle in C. neoformans, and represent a pioneering report in this fungus, regarding genes related to histone modification.

6
  • JUAN MANUEL DINIZ VARGAS ARANCIBIA
  • Investigação do potencial neuroprotetor de tirzepatida em camundongos submetidos a modelo de diabetes e obesidade

  • Orientador : PAULA MARIA QUAGLIO BELLOZI
  • MEMBROS DA BANCA :
  • ANGELICA AMORIM AMATO
  • GABRIELA LOPES MARTINS
  • PAULA MARIA QUAGLIO BELLOZI
  • ROBERTA DOS SANTOS RIBEIRO
  • Data: 29/07/2025

  • Mostrar Resumo
  • A Diabetes Mellitus (DM) é um problema de saúde pública, caracterizado por um estado de hiperglicemia persistente, decorrente de disfunções na secreção e/ou na ação da insulina. A DM pode ser classificada em diferentes tipos, sendo o do tipo 2 o mais comum, frequentemente associada à obesidade, uma doença altamente relacionada com o aumento de marcadores inflamatórios periféricos. Dietas hiperlipídicas podem estar associadas à DM2 e obesidade, predispondo o indivíduo a uma série de comorbidades, como as relacionadas ao sistema nervoso central (SNC). Os incretinomiméticos fazem parte das opções de tratamento de DM2 e obesidade. Além disso, pesquisas recentes demonstraram que alguns incretinomiméticos, como os agonistas de GLP-1, conseguem também atuar como neuroprotetores, contribuindo para a melhora na cognição e do metabolismo do SNC. A tirzepatida, um novo incretinomimético, demostrou ser mais potente para tratar DM2 e obesidade em relação a outros medicamentos dessa classe, como a semaglutida, entretanto, ainda não teve seus efeitos na neuroproteção investigados. Para o presente estudo, camundongos fêmeas C57BL/6 foram submetidos a dieta hiperlipídica (DH) por 12 semanas, e ao tratamento com tirzepatida durante as 4 últimas semanas de dieta. Para avaliação do modelo de DM2 e obesidade, os animais foram pesados semanalmente e submetidos ao teste de tolerância à glicose. Após o tratamento, foram realizados testes comportamentais para avaliar parâmetros relacionados ao SNC como cognição e comportamento tipo-depressivo. Os animais foram eutanasiados e seus hipocampos foram dissecados para avaliação do metabolismo por oximetria de alta resolução. De acordo com os resultados, a tirzepatida conseguiu reverter o ganho de peso, a hiperglicemia em jejum e a tolerância à glicose que foram induzidos pela DH nos animais. Além disso, a DH induziu um déficit cognitivo no teste de realocação de objetos e comportamento do tipo-depressivo no splash test, o que não foi revertido pela tirzepatida. Ainda, houve comprometimento do metabolismo energético hipocampal induzido pela dieta hiperlipídica, que não foi revertido pela tirzepatida. Esses resultados podem não ter sido revertidos devido ao alto teor de lipídios na dieta. Ademais, outros testes precisam ser realizados para avaliação mais completa dos impactos centrais, assim como deve ser realizado um estudo em animais machos para avaliação da resposta sexo-dependente. Baseado na literatura, espera-se que que a tirzepatida tenha efeito neuroprotetor em outros comportamentos e na neuroinflamação.


  • Mostrar Abstract
  • Diabetes Mellitus (DM) is a public health concern characterized by a persistent hyperglycemic state resulting from dysfunctions in insulin secretion and/or action. DM can be classified into different types, with type 2 diabetes (T2DM) being the most prevalent. T2DM is frequently associated with obesity, a condition strongly linked to increased peripheral inflammatory markers. High-fat diets (HFD) are known to contribute to the development of T2DM and obesity, predisposing individuals to various comorbidities, including those affecting the central nervous system (CNS). Incretin mimetics are among the therapeutic options for T2DM and obesity. Furthermore, recent studies have shown that certain incretin-based drugs, such as GLP-1 receptor agonists, may also exert neuroprotective effects, contributing to improvements in cognition and CNS metabolism. Tirzepatide, a novel dual GIP/GLP-1 receptor agonist, has shown superior efficacy in treating T2DM and obesity when compared to other drugs in this class, such as semaglutide. However, its potential neuroprotective effects remain largely unexplored. In the present study, female C57BL/6 mice were subjected to a high-fat diet (HFD) for 12 weeks and received tirzepatide treatment during the final 4 weeks of the diet. To assess the T2DM and obesity model, animals were weighed weekly and underwent an oral glucose tolerance test (OGTT). Following treatment, behavioral tests were conducted to evaluate CNS-related parameters, including cognition and depressive-like behavior. After euthanasia, the hippocampus was dissected for high-resolution respirometry analysis to assess energy metabolism. According to the results, tirzepatide was able to reverse body weight gain, fasting hyperglycemia, and impaired glucose tolerance induced by the HFD. However, HFD-induced cognitive deficits in the object location task and depressive-like behavior in the splash test were not reversed by tirzepatide. Additionally, HFD impaired hippocampal energy metabolism, which was also not restored by tirzepatide treatment. These effects may not have been reversed due to the high lipid content of the diet. Further studies are necessary to provide a more comprehensive evaluation of CNS outcomes, including male mice, to assess sex-dependent responses. Based on the literature, tirzepatide is expected to exert neuroprotective effects in other behavioral domains and in the context of neuroinflammation.

7
  • PEDRO FELIPE DE SOUSA QUEIROZ
  • MÉTODO DIAGNÓSTICO BASEADO EM FRET-HCR E ATIVIDADE DE RIBOZIMAS PARA INFLUENZA AVIÁRIA (H5N1): PROGRAMA COMPUTACIONAL PARA ANÁLISE E PROCESSAMENTO DOS DADOS DE FLUORÍMETRO.

  • Orientador : CINTIA MARQUES COELHO
  • MEMBROS DA BANCA :
  • CINTIA MARQUES COELHO
  • ILDINETE SILVA PEREIRA
  • MARCIO JOSE POCAS FONSECA
  • PRISCILA GRYNBERG
  • Data: 20/08/2025

  • Mostrar Resumo
  • O aumento expressivo no número de casos de influenza aviária representa uma ameaça global significativa, dada a alta patogenicidade do vírus H5N1, pertencente à família Orthomyxoviridae. Desde 2003, esse subtipo viral foi responsável por mais de 964 infecções humanas e 466 óbitos, resultando em uma taxa de letalidade aproximada de 60%. A recente identificação da transmissão viral para mamíferos, como bovinos leiteiros nos Estados Unidos e suínos, estes últimos reconhecidos como potenciais hospedeiros intermediários para humanos, intensificam a preocupação quanto ao risco de disseminação e adaptação interespécies. O Brasil, segundo maior produtor mundial de carne de frango, confirmou 171 casos da doença em aves silvestres, sete em aves domésticas e um em plantel comercial, levando à declaração de estado de emergência zoossanitária. Diante desse cenário, torna-se evidente a necessidade de estratégias diagnósticas mais acessíveis e eficazes, que permitam o rastreamento rápido da disseminação viral permitindo a aplicação de políticas públicas para a contenção. Embora métodos como PCR e ELISA apresentem alta sensibilidade e especificidade, suas limitações, como o elevado custo, a dependência de enzimas, a exigência por equipamentos especializados e a necessidade de cadeia de frio, dificultam sua implementação em larga escala, especialmente em regiões com infraestrutura limitada. Neste contexto, este estudo propôs a avalição de um sistema diagnóstico baseado na integração de ribozimas do tipo hammerhead a moléculas fluorescentes de DNA em formato de grampo. Essas foram projetadas para ativar uma Reação de Hibridização em Cadeia (HCR), resultando na formação de polímeros fluorescentes capazes de promover a Transferência de Energia por Ressonância Fluorescente (FRET), permitindo assim a detecção específica do material genético viral do subtipo H5N1. A metodologia envolveu o alinhamento de genomas do H5N1 para a identificação de regiões conservadas, a partir das quais foram desenhadas ribozimas e repórteres estruturadas em grampo. A validação experimental compreendeu ensaios de clivagem para aferição da atividade catalítica das ribozimas seguidos por ensaios de fluorescência para mensuração da intensidade do sinal FRETHCR em diferentes condições. O sistema contou ainda com um programa computacional, de fácil utilização, capaz de interpretar os sinais emitidos e apresentar os resultados de forma gráfica. Os resultados obtidos demonstraram a viabilidade do sistema proposto na detecção específica do H5N1, com elevada seletividade frente à variante H7N9, evidenciando seu potencial como uma ferramenta diagnóstica alternativa, acessível, rápida e independente de atividade proteica.


  • Mostrar Abstract
  • The significant increase in avian influenza cases represents a major global threat, given the high pathogenicity of the H5N1 virus, which belongs to the Orthomyxoviridae family. Since 2003, this viral subtype has been responsible for over 964 human infections and 466 deaths, resulting in a case fatality rate of approximately 60%. The recent identification of viral transmission to mammals, such as dairy cattle in the United States and swine, recognized as potential intermediate hosts for humans, has heightened concerns regarding the risk of interspecies spread and adaptation. In Brazil, the world’s second-largest producer of chicken meat, 171 cases of the disease have been confirmed in wild birds, seven in domestic birds, and one in a commercial flock, leading to the declaration of a national animal health emergency. Given this scenario, there is a clear need for more accessible and effective diagnostic strategies that enable rapid tracking of viral dissemination and support the implementation of public health policies for containment. Although conventional methods such as PCR and ELISA offer high sensitivity and specificity, their limitations, including high cost, reliance on enzymatic activity, requirements for specialized equipment, and cold chain logistics, posing significant barriers to large-scale deployment, particularly in resource-limited settings. In this context, this study evaluated a diagnostic system based on the integration of hammerhead ribozymes with hairpin-structured fluorescent DNA probes. These probes were designed to trigger a Hybridization Chain Reaction (HCR), resulting in the formation of fluorescent polymers capable of promoting Fluorescence Resonance Energy Transfer (FRET), thus enabling the specific detection of H5N1 viral genetic material.The methodology involved the alignment of H5N1 genomes to identify conserved regions, from which catalytic ribozymes and hairpin DNA probes were designed. Experimental validation included cleavage assays to assess ribozyme catalytic activity and fluorescence assays to quantify FRET-HCR signal intensity under various conditions. The system also incorporates a lightweight, user-friendly software capable of interpreting fluorescence signals and generating graphical results. The results demonstrated the feasibility of the proposed system for the specific detection of H5N1, with high selectivity against the H7N9 variant, highlighting its potential as an alternative diagnostic tool that is accessible, rapid, and independent of protein-based enzymatic activity.

8
  • Priscila Mendes Ferreira
  • “Avaliação das propriedades biológicas de um peptídeo antimicrobiano do anuro Boana albopunctata identificado a partir de banco de cDNAs”.

  • Orientador : MARIANA DE SOUZA CASTRO
  • MEMBROS DA BANCA :
  • MARIANA DE SOUZA CASTRO
  • MONICA PEREIRA GARCIA
  • SEBASTIEN OLIVIER CHARNEAU
  • FERNANDA DE ASSIS ARAÚJO
  • Data: 22/08/2025

  • Mostrar Resumo
  • Peptídeos antimicrobianos (PAMs) são moléculas presentes no sistema imunológico inato de diversos organismos, incluindo plantas, insetos e vertebrados, com ação direta contra microrganismos patogênicos, como bactérias, fungos, protozoários e vírus, além de atuarem também sobre células tumorais. Entre os PAMs de maior interesse estão aqueles isolados da secreção de anuros (sapos, rãs e pererecas), que possuem um amplo espectro de ação e se destacam pelo seu potencial terapêutico. Esses peptídeos, encontrados nas glândulas cutâneas de anuros, atuam por meio de mecanismos que envolvem a interação direta com as membranas celulares dos patógenos, resultando em sua destabilização e morte e também por mecanismos intracelulares atingindo alvos-chave para a viabilidade celular. O potencial terapêutico dos PAMs de anuros é particularmente promissor diante do crescente problema da resistência bacteriana aos antibióticos tradicionais. A capacidade desses peptídeos de atuar de forma eficaz em patógenos resistentes faz deles uma alternativa interessante para o desenvolvimento de novos tratamentos. Além disso, estudos têm explorado suas propriedades imunomoduladoras e cicatrizantes, sugerindo aplicações em doenças infecciosas, na aceleração de processos de cura e em terapias para infecções virais emergentes, como a COVID-19. No presente trabalho, foi sintetizado por síntese química empregando-se a técnica Fmoc, uma raniseptina identificada a partir de uma biblioteca de cDNAs produzida da pele do anuro Boana albopuctata. Tal peptídeo, denominado raniseptina Ba-1, apresentou alta similaridade com as raniseptinas isoladas da espécie Boana raniceps. Em estudos de atividade antimicrobiana, mostrou-se capaz de inibir o crescimento de diversas bactérias patogênicas e de inibir a formação de biofilme da bactéria Pseudomonas aeruginosa. Exibiu efeitos citotóxicos em cultura de macrófagos RAW 264.7 na presença e na ausência de LPS e foi capaz de alterar a taxa de migração de neutrófilos. Em análises por dicroísmo circular, o peptídeo foi capaz de adotar conformação em a-hélice na presença de trifluoretanol e SDS. Em conclusão, a raniseptina Ba-1 exibiu atividade antimicrobiana e conformação em a-hélice, além de efeitos citotóxicos e imunomoduladores em culturas celulares, sugerindo seu potencial terapêutico como agente antimicrobiano.


  • Mostrar Abstract
  • Antimicrobial peptides (AMPs) are molecules present in the innate immune system of several organisms, including plants, insects and vertebrates, with direct action against pathogenic microorganisms, such as bacteria, fungi, protozoa and viruses, in addition to acting on tumor cells. Among the AMPs of greatest interest are those isolated from the secretion of anurans (frogs, toads and tree frogs), which have a broad spectrum of action and stand out for their therapeutic potential. These peptides, found in the cutaneous glands of anurans, act through mechanisms that involve direct interaction with the cell membranes of pathogens, resulting in their destabilization and death, and also through intracellular mechanisms reaching key targets for cell viability. The therapeutic potential of anuran AMPs is particularly promising given the growing problem of bacterial resistance to traditional antibiotics. The ability of these peptides to act effectively on resistant pathogens makes them an interesting alternative for the development of new treatments. Furthermore, studies have explored its immunomodulatory and healing properties, suggesting applications in infectious diseases, in accelerating healing processes and in therapies for emerging viral infections, such as COVID-19. In the present work, a raniseptin identified from a cDNA library produced from the skin of the anuran Boana albopuctata was synthesized by chemical synthesis using the Fmoc technique. This peptide, called raniseptin Ba-1, showed high similarity to raniseptins isolated from the species Boana raniceps. In assays of antimicrobial activity, it was shown to be capable of inhibiting the growth of several pathogenic bacteria and inhibiting the formation of biofilm by the bacterium Pseudomonas aeruginosa. It exhibited cytotoxic effects in RAW 264.7 macrophage cultures in the presence and absence of LPS and was able to alter the neutrophil migration rate. In circular dichroism analyses, the peptide was able to adopt an α-helical conformation in the presence of trifluoroethanol and SDS. In conclusion, raniseptin Ba-1 exhibited antimicrobial activity and α-helical conformation, as well as cytotoxic and immunomodulatory effects in cell cultures, suggesting its therapeutic potential as an antimicrobial agent.

9
  • SOPHIA GARCIA DE RESENDE
  • Método de detecção para dengue baseado no uso de ribozimas e transferência de fluorescência por reação de hibridização em cadeia (FRET-HCR)

  • Orientador : CINTIA MARQUES COELHO
  • MEMBROS DA BANCA :
  • CINTIA MARQUES COELHO
  • DANIELA MARA DE OLIVEIRA
  • DANIEL OLIVEIRA DA MATA
  • ROSÂNGELA VIEIRA DE ANDRADE
  • Data: 25/08/2025

  • Mostrar Resumo
  • A crescente disseminação e incidência do vírus da dengue (DENV) é uma preocupação mundial, com mais de 14 milhões de casos e 11 mil óbitos em 2024. No Brasil, desde 2023, foram notificados 9.7 milhões de casos prováveis e 8.713 óbitos associados ao vírus. Esse cenário evidencia a urgência por soluções mais eficazes, já que as técnicas atuais apresentam limitações, como altos custos logísticos decorrentes da dependência de amplificação enzimática e da exigência de mãode-obra qualificada e equipamentos especializados. Soma-se a isso a sobreposição clínica dos sintomas de DENV com outros arbovírus circulantes, como Zika e Chikungunya, reforçando a demanda por métodos que unam sensibilidade, especificidade e acessibilidade. A detecção precisa e sensível do DENV é essencial para o manejo clínico diferencial, vigilância epidemiológica, desenvolvimento científico e testes vacinais. Ribozimas — RNAs catalíticos envolvidos em mecanismos ribossômicos e de splicing— são estudadas desde os anos 1980 em aplicações terapêuticas e diagnósticas. Paralelamente, técnicas fluorescentes baseadas em ácidos nucleicos demonstram potencial na detecção de sequências virais. Neste estudo, apresenta-se uma estratégia diagnóstica inovadora e livre de enzimas para DENV, que integra ribozimas hammerhead a sondas de DNA fluorescentes em estrutura de grampo. Essas sondas iniciam uma Reação de Hibridização em Cadeia (HCR, do inglês Hybridization Chain Reaction), formando polímeros fluorescentes capazes de promover Transferência de Energia por Ressonância Fluorescente (FRET, do inglês Fluorescence Resonance Energy Transfer), viabilizando a detecção específica do genoma viral. No desenvolvimento do método, sequências genômicas do DENV de dados públicos foram alinhadas e selecionadas manualmente a fim de identificar regiões altamente conservadas; a partir delas, ribozimas e sondas de DNA foram desenhadas. A validação experimental envolveu ensaios de clivagem para análise da atividade das ribozimas, seguidos por ensaios de fluorescência para quantificação do sinal FRET-HCR em diferentes condições. Os resultados demonstraram detecção específica e eficaz do RNA de DENV, com mínima reatividade cruzada frente a Zika e Chikungunya. Essa abordagem configura uma promissora ferramenta diagnóstica de acessível, rápida e independente de enzimas


  • Mostrar Abstract
  • The escalating global prevalence and incidence of dengue virus (DENV) infections are of great concern, with 14 million cases and 11 thousand deaths associated with DENV infection. In Brazil, approximately 9.7 million probable cases and 8,713 related deaths have been reported since 2023, underscoring the urgent need for more effective diagnostic solutions. Current diagnostic techniques often face limitations, including high logistical costs due to reliance on enzymatic amplification and the requirement for specialized labor and equipment. Furthermore, the overlapping clinical symptoms among DENV and other co-circulating arboviruses, such as Zika and Chikungunya, emphasize the critical demand for diagnostic methods that combine high sensitivity, specificity, and accessibility. Accurate and sensitive DENV detection is crucial for differential clinical management, epidemiological surveillance, scientific advancement, and vaccine development. Ribozymes—catalytic RNAs involved in ribosomal and splicing mechanisms—have been investigated for therapeutic and diagnostic applications since the 1980s. In parallel, nucleic acid-based fluorescence techniques have demonstrated significant potential for detecting specific viral sequences. In this study, an innovative enzyme-free diagnostic strategy for DENV is presented, integrating hammerhead ribozymes with fluorescent DNA hairpin probes. These probes initiate a Hybridization Chain Reaction (HCR), leading to the formation of fluorescent polymers capable of enabling Fluorescence Resonance Energy Transfer (FRET), which allows for the specific detection of the viral genome. For method development, DENV genomic sequences from public databases were aligned and manually selected to identify highly conserved regions. Ribozymes and complementary DNA probes were subsequently designed based on these conserved sequences. Experimental validation included cleavage assays to assess ribozyme activity, followed by fluorescence assays to quantify FRET-HCR signals under various conditions. The results demonstrated successful and specific detection of DENV RNA, with minimal cross-reactivity to Zika and Chikungunya RNA. This approach represents a promising diagnostic tool that is accessible, rapid, and enzyme-free.

10
  • MILENA SANTOS DURÃO
  • Nanowarming como alternativa para o aquecimento de tecido ovariano bovino vitrificado

  • Orientador : CAROLINA MADEIRA LUCCI
  • MEMBROS DA BANCA :
  • CAROLINA MADEIRA LUCCI
  • CHRISTIANI ANDRADE AMORIM
  • JOSE FELIPE WARMLING SPRICIGO
  • MARGOT ALVES NUNES DODE
  • Data: 28/08/2025

  • Mostrar Resumo
  • A vitrificação de tecido ovariano é uma técnica promissora para a preservação da fertilidade de mulheres submetidas a tratamentos gonadotóxicos ou com falência ovariana precoce. Este estudo avaliou o uso da tecnologia de nanowarming como alternativa ao método convencional de reaquecimento por banho-maria, visando otimizar a criopreservação de tecido ovariano bovino por vitrificação. Inicialmente, foram testadas cinco concentrações de nanopartículas para determinar a curva de aquecimento, sendo selecionadas as concentrações de 8, 10 e 12 mg NP/mL para a etapa experimental. As amostras foram distribuídas em cinco grupos (n=5): controle fresco, vitrificação com banho-maria, e vitrificação com nanowarming nas três concentrações selecionadas. As análises foram realizadas por meio de curvas de aquecimento e avaliação histológica. Os resultados indicaram que o grupo tratado com 10 mg NP/mL apresentou maior eficiência na taxa de aquecimento e menor variação térmica, alcançando 37 °C mais rapidamente. Morfologicamente, esse grupo apresentou percentual de folículos normais semelhante ao controle e superior aos demais grupos (p<0,05). Concluiu se que o uso de nanowarming com 10 mg NP/mL proporcionou melhor preservação da integridade morfológica de folículos pré- antrais em tecido ovariano bovino vitrificado, destacando seu potencial como método promissor de reaquecimento na criobiologia reprodutiva.


  • Mostrar Abstract
  • Ovarian tissue vitrification is a promising technique for preserving the fertility of women undergoing gonadotoxic treatments or with premature ovarian failure. This study evaluated the use of nanowarming technology as an alternative to the conventional water bath rewarming method, aiming to optimize the cryopreservation of bovine ovarian tissue by vitrification. Initially, five nanoparticle concentrations were tested to determine the heating curve, with concentrations of 8, 10, and 12 mg NP/mL selected for the experimental stage. The samples were distributed into five groups (n=5): fresh control, water bath vitrification, and vitrification with nanowarming at the three selected concentrations. Analyses were performed using heating curves and histological evaluation. The results indicated that the group treated with 10 mg NP/mL presented greater efficiency in heating rate and less thermal variation, reaching 37°C more quickly. Morphologically, this group presented a percentage of normal follicles similar to the control group and higher than the other groups (p<0.05). It was concluded that the use of nanowarming with 10 mg NP/mL provided better preservation of the morphological integrity of preantral follicles in vitrified bovine ovarian tissue, highlighting its potential as a promising rewarming method in reproductive cryobiology.

11
  • ALINE DA SILVA MENDES TEIXEIRA
  • EFEITO DA DESLORELINA NA SUPRESSÃO DO CRESCIMENTO FOLICULAR EM VACAS NELORE COM DOENÇA OVARIANA CÍSTICA CRÔNICA

  • Orientador : JOÃO HENRIQUE MOREIRA VIANA
  • MEMBROS DA BANCA :
  • JOÃO HENRIQUE MOREIRA VIANA
  • FERNANDA PAULINI
  • IVO PIVATO
  • LUIZ GUSTAVO BRUNO SIQUEIRA
  • Data: 18/11/2025

  • Mostrar Resumo
  • A supressão da atividade folicular pode ser influenciada por diferentes protocolos hormonais, sendo a deslorelina uma opção promissora para o manejo reprodutivo de vacas Nelore. Este estudo avaliou a dinâmica folicular de vacas Nelore diagnosticadas com doença ovariana cística crônica (COD) tratadas com diferentes doses de implantes subcutâneos de deslorelina. Os animais foram distribuídos em quatro grupos: controle (G0, n=4), grupo 1 (G1, n=4), grupo 2 (G2, n=4) e grupo 3 (G3, n=4), recebendo zero, um, dois e três implantes de 4,7 mg, respectivamente. A dinâmica ovariana foi monitorada semanalmente por ultrassonografia, avaliando o tamanho dos folículos, a contagem de folículos >8 mm e >12 mm, presença de tecido luteal e níveis de progesterona e AMH. Os resultados mostraram que, a partir da quarta semana, os grupos tratados apresentaram redução significativa no diâmetro do maior folículo em relação ao controle (G1: 11,2 ± 0,8 mm; G2: 9,5 ± 0,7 mm; G3: 7,8 ± 0,6 mm vs G0: 18,3 ± 0,9 mm; P<0,05), bem como diminuição no número de folículos >12 mm (G2 e G3, P<0,05) e >8 mm (G2 e G3, a partir da sexta semana, P<0,05). Nos grupos G2 e G3, observouse aumento significativo do tecido luteal nas semanas 1 e 2 (P<0,05) e elevação concomitante nos níveis de progesterona, sem alterações significativas em AMH. Esses achados indicam uma supressão folicular dosedependente, com efeitos mais pronunciados nos grupos que receberam maior número de implantes, sugerindo que implantes de deslorelina podem ser uma alternativa terapêutica para controlar a atividade ovariana em vacas Nelore com COD e fornecer um modelo experimental para estudo da dinâmica folicular sob supressão controlada.


  • Mostrar Abstract
  • Reproductive efficiency is one of the main determinants of the sustainability of cattle production, directly impacting productivity and profitability in livestock systems. Chronic ovarian disease (COD) is a reproductive disorder characterized by the persistence of anovulatory follicles, whose occurrence is associated with management factors and environmental conditions, resulting in temporary infertility and significant economic losses. Despite the relevance of this condition, the therapeutic options currently available show variable effectiveness, highlighting the need for more consistent alternatives. In this context, the present study evaluated the effect of different doses of deslorelin implants, a long-acting GnRH agonist, on the suppression of follicular dynamics in Nelore cows diagnosed with COD. Sixteen Nelore cows clinically diagnosed with COD were randomly assigned to four groups: G0 (control – no treatment), G1 (4.7 mg deslorelin), G2 (9.4 mg), and G3 (14.1 mg). Animals were monitored for up to 14 months with periodic ultrasonographic evaluations and blood sampling for hormonal analysis (progesterone and anti-Müllerian hormone – AMH). Significant effects of time, dose, and their interaction were observed for all follicular diameter-related variables. Treated groups showed progressive reductions in the diameter of the largest follicle and in the number of follicles larger than 12 mm, with significant differences compared to the control group from the fourth week. In G2, complete suppression of medium follicular activity was observed from the 12th week. Additionally, the luteal tissue area significantly increased in treated groups, indicating cyst luteinization, accompanied by elevated serum progesterone levels. No relevant hormonal changes were observed in the control group. The resumption of follicular activity was evidenced by a gradual increase in the proportion of animals with follicles larger than 7 mm in the following months, with earlier return in G3 and later recovery in G2. AMH levels and antral follicle count (AFC) were not significantly affected by treatment, but a positive correlation between both variables became more evident after deslorelin administration in treated groups. In conclusion, deslorelin, at different doses, promoted reversible suppression of follicular dynamics and induced luteinization in Nelore cows with COD, representing a promising alternative for the therapeutic management of this reproductive disorder in beef cattle.

12
  • LAURA EDUARDA FERNANDES FRANÇA
  • ESTUDO DO EFEITO DO DMT (N,N-DIMETILTRIPTAMINA) NA NEUROGÊNESE IN VITRO DE PRIMATAS NÃO-HUMANOS ADULTOS

  • Orientador : DANIELA MARA DE OLIVEIRA
  • MEMBROS DA BANCA :
  • ALINE PIC TAYLOR
  • CINTIA MARQUES COELHO
  • DANIELA MARA DE OLIVEIRA
  • DIEGO SOUSA MOURA
  • Data: 21/11/2025

  • Mostrar Resumo
  • A neurogênese é o processo pelo qual novos neurônios são gerados a partir de células-tronco neurais ou progenitores neuronais. No cérebro adulto, sua ocorrência é restrita a nichos específicos e de baixa atividade, o que representa um dos principais desafios para a regeneração neural. Nesse contexto, compostos endógenos como o N,Ndimetiltriptamina (DMT) vêm sendo estudados por seu potencial de estimular vias neurotróficas e neurogênicas. Este trabalho avaliou o efeito do DMT sobre a viabilidade celular e o crescimento de neuroesferas derivadas de primatas não humanos adultos. No ensaio de viabilidade MTT, em 72h, o DMT apresentou um perfil bifásico: a dose de 200 mg/L aumentou a atividade metabólica celular em aproximadamente 31%, enquanto 800 mg/L reduziu a viabilidade para cerca de 30%, caracterizando o limite entre efeito trófico e tóxico. No teste de neuroesferas (0,1–1000 µM), observouse que o tempo de cultivo foi o principal determinante do crescimento, mas o DMT modulou a maturação das esferas, reduzindo o número das intermediárias e favorecendo o aumento das maiores (>500 µm). No sétimo dia, as doses de 100 µM e 1000 µM (≈188 mg/L) apresentaram maior proporção de esferas grandes, indicando maturação neuronal mais avançada sem prejuízo à viabilidade celular. O ensaio complementar com doses de 2–2000 mg/L confirmou o padrão observado: 200 mg/L manteve o crescimento e a viabilidade ideais, enquanto concentrações mais altas apresentaram toxicidade. Conclui-se que o DMT atua como modulador neurotrófico, promovendo crescimento, viabilidade e maturação neuronal de forma dose-dependente, com efeito ótimo em torno de 200 mg/L, corroborando seu potencial para estimular neurogênese em tecidos adultos.


  • Mostrar Abstract
  • Neurogenesis is the process by which new neurons are generated from neural stem or progenitor cells. In the adult brain, it occurs only in specific, low-activity niches, posing one of the main challenges to neural regeneration. In this context, endogenous compounds such as N,N-dimethyltryptamine (DMT) have been investigated for their potential to stimulate neurotrophic and neurogenic pathways. This study evaluated the effect of DMT on cell viability and neurosphere growth derived from adult non-human primates. In the MTT viability assay (72 h), DMT displayed a biphasic profile: the 200 mg/L dose increased cellular metabolic activity by approximately 31%, while 800 mg/L reduced viability to around 30%, defining the threshold between trophic and toxic effects. In the neurosphere assay (0.1–1000 µM), the culture time was the main determinant of growth; however, DMT modulated sphere maturation, reducing intermediate-sized clusters and promoting an increase in larger spheres (>500 µm). On day 7, the 100 µM and 1000 µM (≈188 mg/L) groups showed a higher proportion of large spheres, indicating enhanced neuronal maturation without loss of viability. The complementary assay (2–2000 mg/L) confirmed this pattern: 200 mg/L maintained optimal growth and viability, while higher concentrations exhibited cytotoxicity. These results demonstrate that DMT acts as a dosedependent neurotrophic modulator, promoting cell growth, viability, and neuronal maturation, with an optimal effect around 200 mg/L, reinforcing its potential to stimulate neurogenesis in adult neural tissues.

Teses
1
  • Melissa Shizue de Almeida Yamashita
  • Edição genômica utilizando a ferramenta CRISPR/Cas9 em células e embriões para inserção de genes de interesse no locus H11 no genoma bovino

  • Orientador : EDUARDO DE OLIVEIRA MELO
  • MEMBROS DA BANCA :
  • CARLOS FREDERICO MARTINS
  • CINTIA MARQUES COELHO
  • EDUARDO DE OLIVEIRA MELO
  • MAURÍCIO MACHAIM FRANCO
  • RICARDO ALAMINO FIGUEIREDO
  • Data: 12/02/2025

  • Mostrar Resumo
  • O Brasil possui o maior rebanho comercial bovino do mundo com mais de 210 milhões de cabeças de gado, além de ser atualmente o maior exportador de carne bovina. Com o crescimento dessa atividade econômica também é crescente a demanda para o emprego de tecnologias avançadas, entre elas a produção de animais geneticamente modificados (AGM) que venham a abordar problemas desde aumento da produtividade até sanidade animal. Com esse projeto, intencionamos investigar o uso do sistema CRISPR/Cas9 como modelo para estabelecimento de uma metodologia de edição genômica visando a inserção (knock-in) direta de genes de interesse biotecnológico, agropecuário, ou industrial no locus H11 do genoma bovino (Bos taurus). Esse estudo analisou em células bovinas a capacidade do sistema CRISPR/Cas9 em inserir cassetes de expressão de um gene repórter (eGFP) em um sítio específico e seguro do genoma, denominado locus H11. Diversos RNA guias foram testados e avaliados quanto sua capacidade de gerar INDELs por meio do ensaio com T7E1 e confirmados com sequenciamento do tipo Sanger. Também foi avaliado o uso de estimuladores e inibidores que poderiam auxiliar no knock-in, como o SCR7 (inibidor da DNA ligase IV), RS-1 (estimulador da Rad51) e L755507 (agonista do receptor β-3 adrenérgico). Em uma segunda fase, foi realizada eletroporação do sistema CRISPR/Cas9 diretamente em zigotos bovinos. Nos zigotos bovinos, foi realizado eletroporação do complexo núcleoproteico CRISPR/Cas (RNP = gRNA + proteína Cas9) e do cassete de expressão do eGFP linear, com posterior observação da expressão do gene eGFP nos embriões. Além disso, foi amplificado por PCR a região em que o guia direciona clivagem e realizado sequenciamento do tipo Sanger de tal região para avaliar a ocorrência de INDELs. Esse projeto busca, portanto, a incorporação dos mais recentes avanços no campo da edição genômica direta em genomas complexos como o de mamíferos para criação de soluções inovadoras para biotecnologia animal, como a introdução de genes em um locus específico e seguro do genoma bovino


  • Mostrar Abstract
  • Brazil has the world's largest commercial cattle herd, with over 210 million heads, and is currently the largest exporter of beef. As this economic activity grows, so does the demand for the application of advanced technologies, including the production of genetically modified animals (GMAs) to address issues ranging from increased productivity to animal health. This project aims to investigate the use of the CRISPR/Cas9 system as a model for establishing a genome editing methodology aimed at the direct insertion (knock-in) of biotechnological, agricultural, or industrial genes of interest into the H11 locus of the bovine genome (Bos taurus). This study analyzed the capability of the CRISPR/Cas9 system in bovine cells to insert expression cassettes of a reporter gene (eGFP) into a specific and safe site of the genome, known as the H11 locus. Several guide RNAs were tested and evaluated for their ability to generate INDELs through a T7E1 assay, confirmed by Sanger sequencing. The use of stimulators and inhibitors that could improve knock-in, such as SCR7 (DNA ligase IV inhibitor), RS-1 (Rad51 stimulator), and L755507 (β-3 adrenergic receptor agonist), was also assessed. In a second phase, electroporation of the CRISPR/Cas9 system was carried out directly in bovine zygotes. The CRISPR/Cas protein complex (RNP = gRNA + Cas9 protein) and the linear eGFP expression cassette were electroporated into bovine zygotes, with subsequent observation of eGFP gene expression in the embryos. Additionally, the region targeted by the guide was amplified by PCR, and Sanger sequencing of this region was performed to assess the occurrence of INDELs. Thus, this project seeks to incorporate the latest advancements in the field of direct genome editing of complexes genomes like mammalians to create innovative solutions for animal biotechnology, such as the introduction of genes into a specific and safe locus of the bovine genome.

2
  • Jéssica Mendes de Souza
  • "Desenvolvimento do Sistema de Codificação de Ação Facial baseado na descrição anatômica da musculatura facial em Sapajus sp."

  • Orientador : MARIA CLOTILDE HENRIQUES TAVARES
  • MEMBROS DA BANCA :
  • MARIA CLOTILDE HENRIQUES TAVARES
  • LIRIA QUEIROZ LUZ HIRANO
  • CATIA FILIPA CORREIA CAEIRO
  • PATRÍCIA IZAR MAURO
  • TAINA DE ABREU
  • Data: 19/02/2025

  • Mostrar Resumo
  • As expressões faciais são o principal meio de comunicação não-verbal entre os primatas, devido à sua musculatura facial complexa e bem preservada. O Sistema de Codificação de Ação Facial (Facial Action Coding System, FACS) é utilizado para analisar expressões faciais de forma padronizada em humanos e primatas não-humanos, baseando-se nas Unidades de Ação (Action Units, AUs), que descrevem as mudanças visíveis na face causadas pelos movimentos dos músculos faciais. Embora os macacos-prego (Sapajus sp.) possuam um repertório elaborado de expressões faciais, pouco se sabe sobre sua musculatura facial. Esse estudo teve como objetivo identificar os músculos faciais dos macacos-prego e associá-los à variedade de movimentos faciais da espécie, visando o desenvolvimento do SapajusFACS. Seguindo metodologias de adaptações anteriores do FACS, realizamos três etapas. Primeiro, dissecamos quatro espécimes para identificar e descrever detalhadamente os músculos faciais. Em seguida, registramos em vídeo os movimentos faciais de 24 sujeitos mantidos no Centro de Primatologia da Universidade de Brasília. Por fim, identificamos e descrevemos as AUs com base nas informações obtidas nas etapas anteriores. Identificamos 22 músculos faciais e 27 movimentos faciais, sendo 14 AUs nos macacos-prego. Esses animais apresentaram uma complexidade muscular mais elaborada do que previamente descrito e uma mobilidade facial comparável à dos Catarrhini. A caracterização anatômica realizada constituiu como parte importante para o desenvolvimento do SapajusFACS, sendo a primeira feita em detalhes para uma espécie do gênero. A aplicação desse sistema permitirá futuras investigações sobre as expressões faciais desses animais em um contexto comparativo e evolutivo. Isso ajudará a aprofundar o entendimento sobre os papéis comunicativos e emocionais das expressões faciais na ordem dos Primatas, especialmente com a inclusão de um novo táxon nessas comparações. Ampliar essas investigações para além dos estudos focados apenas no Catarrhini é essencial para inferências mais precisas sobre o processo evolutivo da comunicação não-verbal desses animais.


  • Mostrar Abstract
  • Facial expressions are the most important mode of nonverbal communication among primates due to the complexity and highly conserved facial musculature. The Facial Action Coding System (FACS) is a standardized method used to analyze facial expressions in humans and nonhuman primates, based on Action Units (AUs), which describe the visible changes in the face resulting from the movement of individual facial muscles. Although capuchin monkeys (Sapajus sp.) have an elaborate repertoire of facial expressions, their facial musculature is underinvestigated. This study aimed to identify the facial muscles of capuchin monkeys and to correlate this information with the variety of facial movements exhibited by the species to develop the SapajusFACS. The study was conducted in three steps, following the methodology used in previous adaptations of FACS. First, four specimens were dissected to identify and describe the facial muscles in detail. Next, we recorded the facial movements of 24 capuchin monkeys housed at the Primatology Center at the University of Brasilia using videotape. Finally, we identified and described the AUs based on the information gathered in the earlier steps. A total of 22 facial muscles and 27 facial movements (14 AUs) were identified in the capuchin monkeys. These animals exhibited a more elaborate muscular complexity than previously described and facial mobility comparable to the Catarrhini. The anatomical characterization conducted was the first detailed study of this genus and a crucial step in SapajusFACS development. This system will enable future research on the facial expressions of these animals in a comparative and evolutionary context. This approach enhances our understanding of facial expressions' communicative and emotional roles within the Primate order, especially by including a new taxon in these comparisons. Extending these investigations beyond studies that focus solely on Catarrhini is essential to making more accurate inferences about the evolutionary processes of nonverbal communication in these animals.

3
  • Isadora Alves de Vasconcelos
  • "Caracterização química e biológica de Peptídeos Antimicrobianos Curtos (SPAMs) associados a um Motivo de Ligação Amino Terminal Cobre e Níquel (ATCUN)."

  • Orientador : OSMINDO RODRIGUES PIRES JUNIOR
  • MEMBROS DA BANCA :
  • DANIEL CARVALHO PIMENTA
  • GUILHERME DOTTO BRAND
  • LUDOVICO MIGLIOLO
  • MARIANA DE SOUZA CASTRO
  • OSMINDO RODRIGUES PIRES JUNIOR
  • Data: 24/02/2025

  • Mostrar Resumo
  • Os peptídeos antimicrobianos surgiram como um potencial novo tratamento devido à sua capacidade de explorar fraquezas nos mecanismos de resistência aos antibióticos atualmente presentes nas bactérias. Além disso, estudos recentes demonstraram que, quando conjugados a um motivo de ligação de cobre e níquel no terminal amino (ATCUN), os peptídeos antimicrobianos exibem atividade antimicrobiana aprimorada. Portanto, o presente trabalho teve como objetivo caracterizar química e biologicamente o Peptídeo Antimicrobiano Curto (SPAMs) conjugado a um motivo ATCUN contra bactérias, fungos e células. Foram preparados oito análogos de peptídeos antimicrobianos, com e sem adição de motivo ATCUN, e sua atividade inibitória em bactérias (E. coli, K. pneumoniae, P. aeruginosa, S. aureus e S. epidermidis), fungos (C. albicans, C krusei e C. parapsilosis) e células (MCF-7 e NIH-3T3) foram verificadas e testadas quanto à hemólise de glóbulos vermelhos humanos. Todos os peptídeos foram capazes de inibir o crescimento das espécies bacterianas avaliadas com CIMs relativamente baixas, e os quatro peptídeos conjugados ao motivo ATCUN, quando testados para melhorar sua eficiência nas mesmas bactérias, demonstraram um aumento na atividade antimicrobiana em até oito vezes. Os oito peptídeos também foram capazes de inibir o crescimento de pelo menos uma das três cepas de Candida testadas, sendo que um deles foi capaz de aumentar em duas vezes a atividade fungicida contra C. albicans e C. krusei. Três dos peptídeos foram capazes de inibir a proliferação de células MCF-7 com valores relativamente baixos de IC50 (13,83, 20,17 e 19,51 µM, respectivamente), sendo que o peptídeo ssp4-ATCUN indica uma possível seletividade em relação à linhagem neoplásica, enquanto o peptídeo ssp4-ATCUN indica uma possível seletividade em relação à linhagem neoplásica, enquanto o peptídeo ssp4-ATCUN outros dois (ssp3 e ssp3- ATCUN) também inibiram a proliferação de NIH-3T3 (IC50 de 49,92 e 16,29 µM, respectivamente). Os péptidos geralmente não demonstraram actividade hemolítica. Assim, demonstramos neste trabalho que os peptídeos antimicrobianos descritos possuem potente atividade bactericida contra microrganismos e que a associação destes peptídeos com um motivo ATCUN pode aumentar sua atividade bactericida em duas a oito vezes, dependendo do peptídeo e do patógeno analisado. Além disso, também pode ser observado que os peptídeos possuem atividade antifúngica e antiproliferativa em células neoplásicas, com possível potencialização destas atividades por peptídeos contendo o motivo ATCUN


  • Mostrar Abstract
  • Antimicrobial peptides have emerged as a potential new treatment due to their ability to exploit weaknesses in antibiotic resistance mechanisms currently present in bacteria. In addition, recent studies have demonstrated that when conjugated to an Amino Terminal Copper and Nickel (ATCUN) Binding Motif, antimicrobial peptides exhibit enhanced antimicrobial activity. Therefore, the present work aimed to chemically and biologically characterize Short Antimicrobial Peptide (SPAMs) conjugated to an ATCUN motif against bacteria, fungi, and cells. Eight analogues of antimicrobial peptides were prepared, with and without the addition of an ATCUN motif, and their inhibitory activity on bacteria (E. coli, K. pneumoniae, P. aeruginosa, S. aureus and S. epidermidis), fungi (C. albicans, C krusei and C. parapsilosis), and cells (MCF-7 and NIH-3T3) was verified and tested for hemolysis of human red blood cells. All peptides were able to inhibit the growth of the bacterial species evaluated with relatively low MICs, and the four peptides conjugated to the ATCUN motif, when tested for improving their efficiency on the same bacteria, demonstrated an increase in antimicrobial activity up to eight times. The eight peptides were also able to inhibit the growth of at least one of the three strains of Candida tested, and one of them was able to increase the fungicidal activity against C. albicans and C. krusei in twice. Three of the peptides were able to inhibit the proliferation of MCF-7 cells with relatively low IC50 values (13.83, 20.17 and 19.51 µM, respectively), with the ssp4-ATCUN peptide indicating a possible selectivity in relation to the neoplastic lineage, while the other two (ssp3 and ssp3-ATCUN) also inhibited the proliferation of NIH-3T3 (IC50 of 49.92 and 16.29 µM, respectively). Peptides generally have not demonstrated hemolytic activity. Thus, we demonstrated in this work that the described antimicrobial peptides have potent bactericidal activity against microorganisms and that the association of these peptides with an ATCUN motif can increase their bactericidal activity by two to eight times, depending on the peptide and the pathogen analyzed. Furthermore, it can also be observed that the peptides have antifungal and antiproliferative activity on neoplastic cells, with a possible enhancement of these activities by peptides containing the ATCUN motif

4
  • Fabiano Fagundes Moser da Silva
  • Avaliação das propriedades biológicas de análogos do peptídeo antimicrobiano Bc77(K) isolado da secreção cutânea do anuro Boana crepitans

  • Orientador : MARIANA DE SOUZA CASTRO
  • MEMBROS DA BANCA :
  • MARIANA DE SOUZA CASTRO
  • OSMINDO RODRIGUES PIRES JUNIOR
  • TAIA MARIA BERTO REZENDE
  • KARLA DE ALELUIA BATISTA
  • MARCELO HENRIQUE SOLLER RAMADA
  • Data: 30/05/2025

  • Mostrar Resumo
  • A resistência de microrganismos aos antibióticos disponíveis é um grave problema de saúde pública, dificultando o tratamento de infecções comuns. Peptídeos antimicrobianos surgem como promissoras alternativas terapêuticas, atuando de forma rápida e multifatorial, com menor risco de induzir resistência, sendo potenciais candidatos ao desenvolvimento de novos fármacos. Este projeto teve como objetivo geral propor e sintetizar quimicamente novos análogos do peptídeo antimicrobiano Bc77(K) isolado da secreção cutânea de Boana crepitans e avaliar: 1) seus efeitos antimicrobianos sobre diferentes patógenos (bactérias, fungos e vírus), 2) seus efeitos antiproliferativos em linhagens de células de mamíferos (HeLa e HaCaT) e 3) seus efeitos na ativação e quimiotaxia de neutrófilos humanos. Após a realização dos ensaios, os resultados obtidos evidenciaram que os análogos 1, 2 e 3 demonstraram ampla ação antimicrobiana. O análogo 2 foi o mais eficaz contra bactérias Gram-negativas e Gram-positivas, incluindo cepas multirresistentes, como Acinetobacter baumannii, com reduções de até 7 CIMs. Também apresentou forte atividade antifúngica contra Candida albicans, enquanto os análogos 1 e 3 mostraram atividade moderada. Em testes antivirais com SARS-CoV-2, os peptídeos analisados não foram capazes de inibir a multiplicação do vírus, sendo que alguns exibiram efeitos citotóxicos relevantes. Em relação à atividade antiproliferativa, os peptídeos inibiram a proliferação da linhagem tumoral HeLa, embora sem seletividade frente à linhagem celular não-tumoral HaCaT. Quanto à resposta imune, os peptídeos apresentaram ação quimiotática sobre neutrófilos. Bc77(K) mostrou maior quimiotaxia, enquanto os análogos 1 e 2 também induziram migração de neutrófilos em tempo real. Além disso, os análogos 1 e 2 foram eficazes na destruição de biofilmes bacterianos préformados, com destaque para o análogo 1. Todos os peptídeos exibiram capacidade de adotar conformação em a-hélice na presença de SDS, um composto membrana-mimético. Assim, os análogos 1, 2 e 3 são candidatos promissores como agentes antimicrobianos e imunomoduladores, com possíveis aplicações terapêuticas. 


  • Mostrar Abstract
  • The resistance of microorganisms to available antibiotics is a serious public health issue, making the treatment of common infections more difficult. Antimicrobial peptides have emerged as promising therapeutic alternatives due to their rapid and multifactorial action and lower risk of inducing resistance, positioning them as potential candidates for the development of new drugs. This project aimed to design and chemically synthesize new analogues of the antimicrobial peptide Bc77(K), isolated from the skin secretion of Boana crepitans, and to evaluate: (1) their antimicrobial effects against various pathogens (bacteria, fungi, and viruses); (2) their antiproliferative effects on mammalian cell lines (HeLa and HaCaT); and (3) their effects on human neutrophil activation and chemotaxis. After conducting the experiments, the results showed that analogues 1, 2, and 3 demonstrated broad-spectrum antimicrobial activity. Analogue 2 was the most effective against both Gram-negative and Gram-positive bacteria, including multidrug-resistant strains such as Acinetobacter baumannii, with reductions of up to 7 MICs. It also exhibited strong antifungal activity against Candida albicans, while analogues 1 and 3 showed moderate activity. In antiviral tests with SARS-CoV-2, the peptides analyzed were not able to inhibit the multiplication of the virus, and some exhibited relevant cytotoxic effects. Regarding antiproliferative activity, the peptides inhibited the proliferation of the HeLa tumor cell line, although without selectivity against the non-tumor HaCaT cell line. As for the immune response, the peptides exhibited chemotactic action on neutrophils. Bc77(K) showed greater chemotaxis, while analogues 1 and 2 also induced real-time neutrophil migration. Additionally, analogues 1 and 2 were effective in destroying pre-formed bacterial biofilms, with analogue 1 being particularly notable. All peptides demonstrated the ability to adopt an α-helical conformation in the presence of SDS, a membrane-mimetic compound. Thus, analogues 1, 2, and 3 are promising candidates as antimicrobial and immunomodulatory agents, with potential therapeutic applications.

5
  • ALINE DE QUEIROZ RODRIGUES
  • Impacto do estresse oxidativo nos parâmetros reprodutivos femininos: uma análise de biomarcadores sistêmicos e foliculares para o desenvolvimento de estratégias terapêuticas

  • Orientador : FERNANDA PAULINI
  • MEMBROS DA BANCA :
  • ANGELICA AMORIM AMATO
  • FERNANDA PAULINI
  • LUCIANA LAMARÃO DAMOUS
  • PAULA MARIA QUAGLIO BELLOZI
  • SIDNEY ALCANTARA PEREIRA
  • Data: 26/06/2025

  • Mostrar Resumo
  • O estresse oxidativo é amplamente reconhecido como um fator-chave na fertilidade feminina, por influenciar negativamente a qualidade dos ovócitos e os resultados reprodutivos. Este estudo teve como objetivo investigar as relações entre marcadores de estresse oxidativo sistêmico e folicular e parâmetros reprodutivos em mulheres submetidas a tratamentos de reprodução assistida, com foco na interação entre variáveis demográficas, oxidativas e reprodutivas. Foram avaliadas 49 pacientes com idade média de 36,0 ± 3,5 anos, distribuídas uniformemente pela amostra. Os biomarcadores analisados incluíram glutationa reduzida (GSH), glutationa oxidada (GSSG), glutationa total (tGSH), razão GSSG/GSH, espécies reativas de oxigênio (ERO) e espécies reativas de nitrogênio (ERN). Amostras de sangue e de fluido folicular foram coletadas e analisadas, correlacionando esses marcadores com variáveis como contagem de folículos antrais (CFA), número de ovócitos recuperados, ovócitos maduros, formação de blastocisto e taxas de gravidez. Os resultados indicam que a CFA é um marcador crítico da reserva ovariana, pois se correlaciona positivamente com o número de ovócitos recuperados e maduros, refletindo a influência direta da reserva ovariana na eficiência do tratamento. A idade impacta significativamente os marcadores antioxidantes, com correlações negativas observadas entre a idade e os níveis de GSH, GSSG e tGSH no sangue e no fluido folicular. Essas descobertas sugerem um declínio na capacidade antioxidante sistêmica e local associada ao envelhecimento. No fluido folicular, o aumento nos níveis de GSSG em correlação com o número de ovócitos recuperados sugere atividade metabólica elevada e aumento na geração de ERO, refletindo uma maior carga oxidativa durante a estimulação ovariana. Por outro lado, os níveis de GSH e tGSH no sangue mostraram correlações negativas com o número de ovócitos maduros, indicando consumo sistêmico intensificado de antioxidantes sob condições de alta demanda metabólica. Essas alterações, associadas ao envelhecimento e à estimulação ovariana, ressaltam o impacto do estresse oxidativo na qualidade dos ovócitos e nos resultados reprodutivos, incluindo a formação de blastocistos e as taxas de gravidez. Concluindo, as descobertas demonstram que o equilíbrio redox é essencial para a fertilidade feminina, particularmente em mulheres em idade reprodutiva avançada, um grupo predominante em tratamentos de reprodução assistida. Estratégias clínicas para minimizar o estresse oxidativo, como suplementação antioxidante e monitoramento de marcadores redox, podem ser cruciais para otimizar os tratamentos e proteger a qualidade dos ovócitos. Embora a consistência nas idades das participantes tenha fortalecido a robustez das análises, o pequeno tamanho da amostra destaca a necessidade de estudos futuros com coortes maiores e análises complementares. Estudos futuros podem elucidar ainda mais as interações entre marcadores oxidativos, idade e parâmetros reprodutivos, fornecendo insights valiosos para intervenções personalizadas que incrementem os resultados clínicos.


  • Mostrar Abstract
  • Oxidative stress is widely recognized as a key factor in female fertility, negatively influencing oocyte quality and reproductive outcomes. This study aimed to investigate the relationships between systemic and follicular oxidative stress markers and reproductive parameters in women undergoing assisted reproductive treatments, focusing on the interaction between demographic, oxidative, and reproductive variables. A total of 49 patients with a mean age of 36.0 ± 3.5 years were evaluated, uniformly distributed across the sample. The analyzed biomarkers included reduced glutathione (GSH), oxidized glutathione (GSSG), total glutathione (tGSH), the GSSG/GSH ratio, reactive oxygen species (ROS), and reactive nitrogen species (RNS). Blood and follicular fluid samples were collected and analyzed, correlating these markers with variables such as antral follicle count (AFC), number of oocytes retrieved, mature oocytes, blastocyst formation, and pregnancy rates. The results indicate that AFC is a critical marker of ovarian reserve, as it positively correlates with the number of retrieved and mature oocytes, reflecting the direct influence of ovarian reserve on treatment efficiency. Age significantly impacts antioxidant markers, with negative correlations observed between age and the levels of GSH, GSSG, and tGSH in both blood and follicular fluid. These findings suggest a decline in systemic and local antioxidant capacity associated with aging. In follicular fluid, the increase in GSSG levels in correlation with the number of oocytes retrieved suggests heightened metabolic activity and increased ROS generation, reflecting a greater oxidative load during ovarian stimulation. Conversely, GSH and tGSH levels in blood showed negative correlations with the number of mature oocytes, indicating intensified systemic antioxidant consumption under conditions of high metabolic demand. These alterations, associated with aging and ovarian stimulation, underscore the impact of oxidative stress on oocyte quality and reproductive outcomes, including blastocyst formation and pregnancy rates. In conclusion, the findings demonstrate that redox balance is essential for female fertility, particularly in women of advanced reproductive age, a predominant group in assisted reproductive treatments. Clinical strategies to minimize oxidative stress, such as antioxidant supplementation and monitoring of redox markers, are crucial for optimizing treatments and protecting oocyte quality. While the consistency in participants' ages strengthened the robustness of the analyses, the small sample size highlights the need for future studies with larger cohorts and complementary analyses. These future studies could further elucidate the interactions between oxidative markers, age, and reproductive parameters, providing valuable insights for personalized interventions that improve clinical outcomes

6
  • THYAGO JOSÉ ARRUDA PACHECO
  • METODOLOGIA INOVADORA PARA MODIFICAÇÃO DE PRÓTESE DE CAVIDADE GLENOIDE EM POLIETILENO DE ULTRA ALTO PESO MOLECULAR COM ÓXIDO DE GRAFENO

  • Orientador : JOAO PAULO FIGUEIRO LONGO
  • MEMBROS DA BANCA :
  • FERNANDO HENRIQUE SILVA GARCIA
  • JOAO PAULO FIGUEIRO LONGO
  • MOSAR CORREA RODRIGUES
  • NÍCOLAS OLIVEIRA DE ARAÚJO
  • RODRIGO ANTONIO DE MEDEIROS
  • Data: 26/06/2025

  • Mostrar Resumo
  • Próteses articulares de alta resistência são essenciais para a eficácia do implante e bem-estar do paciente. Polímeros biocompatíveis, tais como o polietileno de alto peso molecular (UHMWPE) são amplamente utilizados em próteses de alta resistência. Esse material pode ser empregado em diferentes tipos de próteses articulares devido a sua alta resistência mecânica, como em próteses do quadril (acetábulo) ou na região temporomandibular (ATM). Todavia, com o tempo, ele pode apresentar desgaste por abrasão, gerando fragmentos de polietileno que são depositados no ambiente articular, recrutando fibroblastos e macrófagos, ocasionando a perda do implante. A reposição da prótese pode causar um grande prejuízo tanto do ponto de vista da saúde do paciente, quanto do ponto de vista do sistema de saúde como um todo. Por isso, inúmeras iniciativas têm sido propostas como o intuito de aumentar o tempo de vida útil desses materiais. Nosso trabalho teve como objetivo o enriquecimento do UHMWPE com óxido de grafeno em uma prótese ATM, a fim de aumentar a vida útil e garantir melhores propriedades mecânicas e antimicrobianas da prótese. Os resultados de caracterização mostraram que o óxido de grafeno foi incorporado com sucesso no material de UHMWPE, apresentou uma resistência maior da prótese de UHMWPE incorporada com óxido de grafeno, além de baixa toxicidade e certa capacidade antimicrobiana. Além disso, por ser considerado um processo inovador, o método utilizado para a incorporação do óxido de grafeno no UHMWPE está sendo depositado como patente de invenção junto ao Instituto Nacional de Propriedade Industrial. Portanto, o óxido de grafeno contribuiu com o aperfeiçoamento das características do material de UHMWPE, sendo promissora a sua aplicação na indústria de próteses, com potencial de gerar menor custo de produção, ser menos oneroso ao estado e melhor bem-estar para os pacientes.


  • Mostrar Abstract
  • High-strength joint prostheses are essential for the effectiveness of the implant and the patient's well-being. Biocompatible polymers such as ultra-high molecular weight polyethylene (UHMWPE) are widely used in high-strength prosthetics. This material can be used in different types of joint prostheses due to its high mechanical resistance, such as in hip (acetabulum) or temporomandibular region (TMJ) prostheses. However, over time, it may wear due to abrasion, generating polyethylene fragments that are deposited in the joint environment, recruiting fibroblasts and macrophages, causing the loss of the implant. Replacing the prosthesis can cause great harm both from the point of view of the patient's health and from the point of view of the health system. Therefore, numerous initiatives have been proposed with the aim of increasing the useful life of these materials. Our work aimed to enrich UHMWPE with graphene oxide in an ATM prosthesis, to increase the useful life and guarantee better mechanical and antimicrobial properties of the prosthesis. The characterization results showed that graphene oxide was successfully incorporated into the UHMWPE material, showed greater resistance of the UHMWPE prosthesis incorporated with graphene oxide, in addition to low toxicity and certain antimicrobial capacity. Furthermore, as it is considered an innovative process, the method used to incorporate graphene oxide into UHMWPE is being filed as an invention patent with the National Institute of Industrial Property. Therefore, graphene oxide contributed to the improvement of the characteristics of the UHMWPE material, making its application in the prosthetics industry promising, with the potential to generate lower production costs, be less costly to the state and improve patient well-being.

7
  • Otávio Augusto Costa de Faria
  • “TRANSFERÊNCIA INTRAFOLICULAR DE OVÓCITOS IMATUROS (TIFOI) COMO UMA ALTERNATIVA PARA A MATURAÇÃO DE OVÓCITOS BOVINOS”.

  • Orientador : MARGOT ALVES NUNES DODE
  • MEMBROS DA BANCA :
  • MARGOT ALVES NUNES DODE
  • EDUARDO DE OLIVEIRA MELO
  • FERNANDA PAULINI
  • JOSE FELIPE WARMLING SPRICIGO
  • MAURÍCIO MACHAIM FRANCO
  • Data: 29/09/2025

  • Mostrar Resumo
  • Varios estudos tem mostrado que a maturação in vitro (MIV) induz a um maior acúmulo de lipídios em ovócitos bovinos. Esse acumulo não é observado quando a maturação é realizada in vivo. Contudo, ainda não se sabe se essa diferença no conteudo lipidico permanecerá após os ovocitos serem fecundados e cultivados in vitro. Portanto, o objetivo deste estudo foi avaliar se o sistema de maturação afeta a produção e qualidade dos embriões. Para isso embriões produzidos in vitro a partir de ovócitos maturados in vitro, in vivo (FSH e TIFOI) foram utilizados. Os ovócitos foram maturados em seus respectivos sistemas de maturação, por vinte e duas horas, recuperados, fecundados (FIV) e cultivados (CIV) in vitro. A taxa de produção e as análises: atividade mitocondrial, quantificação de lipídios, número total de células e a resistência à criopreservação foram comparadas entre os grupos. Os dados relativos à taxa de produção de blastocistos, atividade mitocondrial, quantificação de lipídios, número total de células, foram analisados pelos testes Qui-quadrado e ANOVA (GLIMMIX). Para todas as análises um nível de significância de 5% (P<0,05%) foi considerado. Como esperado, o grupo FSH apresentou uma maior (P<0,05%) taxa de blastocistos que os grupos MIV e TIFOI, que, por sua vez, foram semelhantes. Apesar disto, não houve diferença entre a quantidade total de células e à atividade mitocondrial dos Bx em D7. Contudo, a média da área ocupada pelos lipídios nos embriões MIV (12,9%±7,73) foi superior (P<0,05%) aos embriões FSH (5,81%±4,36) e TIFOI (5,32%±4,08). As análises relacionadas com a resistência à criopreservação e ao número de células apoptóticas ainda não foram realizadas. Até o presente, os resultados parciais demonstram que a TIFOI pode ser utilizada como uma ferramenta para a maturação dos ovócitos in vivo, provendo embriões semelhantes aos produzidos in vivo e, trazendo novas possibilidades para as biotecnicas reprodutivas que necessitam da maturação in vitro de ovócitos.


  • Mostrar Abstract
  • Several studies have demonstrated that in vitro maturation (IVM) induces a greater accumulation of lipids in bovine oocytes. This accumulation is not observed when maturation is performed in vivo. However, it is still unknown whether this difference in lipid content will remain after the oocytes are fertilized and cultured in vitro. Therefore, the objective of this study was/is to assess whether the maturation system affects embryo production and quality. For this, embryos produced in vitro from oocytes matured in vitro, in vivo (FSH and IFIOT) were used. The oocytes were matured in their respective maturation systems for twenty-two hours, and then were fertilized (IVF) and cultured (IVC) in vitro. The production rate and analyses of mitochondrial activity, lipid quantification, total number of cells and resistance to cryopreservation were compared among groups. Data related to blastocyst production rate, mitochondrial activity, lipid quantification and total cell number were analyzed by Chi-square and ANOVA (GLIMMIX) tests. For all analyzes a significance level of 5% (P<0.05%) was considered. As expected, the FSH group had a higher (P<0.05%) blastocyst rate than the IVM and TIFOI groups, which, in turn, were similar. Despite this, there was no difference between the total amount of cells and the mitochondrial activity of Bx in D7. However, the mean area occupied by lipids in IVM embryos (12.9%±7.73) is higher (P<0.05%) than in FSH (5.81%±4.36) and IFIOT (5.32%±4.08) embryos. Analyzes related to resistance to cryopreservation and the number of apoptotic cells have not yet been performed. At the present, the partial results demonstrate that IFIOT can be used as a tool for the maturation of oocytes in vivo, providing embryos similar to those produced in vivo and bringing new possibilities for reproductive technologies that require the in vitro maturation of oocytes.

2024
Dissertações
1
  • WELTHON DE SOUZA TEOTONIO
  • “CARACTERIZAÇÃO QUÍMICA E BIOLÓGICA DE PEPTÍDEOS ANTIMICROBIANOS PRESENTES NA SECREÇÃO CUTÂNEA DOS ANUROS Pithecopus rohdei e Lithobates palmipes”.

  • Orientador : MARIANA DE SOUZA CASTRO
  • MEMBROS DA BANCA :
  • MARIANA DE SOUZA CASTRO
  • TAIA MARIA BERTO REZENDE
  • CARLOS JOSÉ CORREIA DE SANTANA ALMEIDA
  • MARLON HENRIQUE E SILVA CARDOSO
  • Data: 20/08/2024

  • Mostrar Resumo
  • O surgimento de microrganismos com resistência antimicrobiana tem crescido em todo o planeta. Uma das principais causas desse fenômeno é o uso indiscriminado dos antibióticos. Diante da ameaça da emergência de bactérias multirresistentes, a busca por novas formas terapêuticas tornou-se premente. A secreção cutânea de anuros tem se revelado uma fonte riquíssima de moléculas com propriedades farmacológicas, dentre elas os peptídeos antimicrobianos, que se destacam como uma alternativa relevante para o desenvolvimento de novas drogas antimicrobianas. No presente trabalho, foram coletados 11 espécimes do anuro Pithecopus rohdei, cuja secreção cutânea foi obtida por meio de estimulação elétrica de baixa intensidade e a secreção da pele foi coletada com água Milli-Q, liofilizada e armazenada a -20 ºC. Alíquotas de 15 mg da secreção cutânea liofilizada foram resuspendidas em 1 mL de TFA 0,1% em água Milli-Q. Após centrifugação, 200 µL do sobrenadante foram submetidos a RP-HPLC usando coluna C18, resultando na eluição de 27 frações cromatográficas. Tais frações foram manualmente coletadas, secas a vácuo e testadas para verificar sua atividade antimicrobiana, com 15 frações mostrando-se ativas contra bactérias patogênicas. As frações com atividade antimicrobiana foram analisadas por espectrometria de massas do tipo MALDI-TOF. Dentre elas, 3 frações (21, 24 e 25) exibiram componentes com massas moleculares inéditas: 3061,567 Da; 2848,367 Da; 2849,389 Da, respectivamente. Essas frações mostraram-se homogêneas e foram submetidas ao sequenciamento químico por degradação de Edman e, em seguida, a análises de similaridade permitindo identificar 3 novas dermaseptinas presentes nessa secreção cutânea. Também foi caracterizado no presente estudo uma nova ranateurina isolada da secreção cutânea do anuro Lithobates palmipes. Este estudo teve o objetivo de avançar na caracterização química e biológica do arsenal de peptídeos antimicrobianos presentes na secreção da pele dos anuros P. rohdei e L. palmipes.


  • Mostrar Abstract
  • The emergence of microorganisms with antimicrobial resistance is growing throughout the planet. One of the main causes of this phenomenon is the indiscriminate use of antibiotics. In the face of the emergence of multi-resistant bacteria, the search for new therapeutic agents is pressing again. The skin secretion of anurans has revealed a very rich source of molecules with pharmacological properties, among which are antimicrobial peptides, which stand out as a relevant alternative for the development of new antimicrobial drugs. In the present study, 11 specimens of the anuran Pithecopus rohdei, which skin secretion was obtained by means of low-intensity electrical stimulation and this skin secretion was collected with Milli-Q water, freeze-dried and stored at -20 ºC. Aliquots of 15 mg of freeze-dried skin secretion resuspended in 1 mL of TFA 0.1% in Milli-Q water. After centrifugation, aliquots of 200 µL of the supernatant was submitted to RP-HPLC using a C18 column, resulting in elution of 27 chromatographic fractions. These fractions were manually collected, vacuum dried and tested to verify their antimicrobial activity, with 15 fractions showing inhibitory activity against pathogenic bacteria. The fractions with antimicrobial activity were analyzed by MALDI-TOF type mass spectrometry. Three fractions (21, 24 and 25) exhibited components with molecular masses of: 3061.567 Da; 2848.367 Da; 2849.389 Da, respectively. These fractions were shown to be homogeneous and subjected to chemical sequencing by Edman degradation and, subsequently, to similar analyzes allowing the identification of 3 new dermaseptins present in this skin secretion. It was also characterized in the present study a new ranateurin isolated from the skin secretion of the anuran Lithobates palmipes. The aim of the present study was advancing in the chemical and biological characterization of the arsenal of antimicrobial peptides present in the skin secretion of the anurans P. rohdei and L. palmipes.

2
  • Priscila Mendes Ferreira
  • "Avaliação das propriedades biológicas de um peptídeo antimicrobiano de Boana albopunctata derivado de banco de cDNAs."

  • Orientador : MARIANA DE SOUZA CASTRO
  • MEMBROS DA BANCA :
  • FERNANDA DE ASSIS ARAÚJO
  • MARIANA DE SOUZA CASTRO
  • MONICA PEREIRA GARCIA
  • SEBASTIEN OLIVIER CHARNEAU
  • Data: 28/11/2024

  • Mostrar Resumo
  • Peptídeos antimicrobianos (PAMs) são moléculas presentes no sistema imunológico inato de diversos organismos, incluindo plantas, insetos e vertebrados, com ação direta contra microrganismos patogênicos, como bactérias, fungos, protozoários e vírus, além de atuarem também sobre células tumorais. Entre os PAMs de maior interesse estão aqueles isolados da secreção de anuros (sapos, rãs e pererecas), que possuem um amplo espectro de ação e se destacam pelo seu potencial terapêutico. Esses peptídeos, encontrados nas glândulas cutâneas de anuros, atuam por meio de mecanismos que envolvem a interação direta com as membranas celulares dos patógenos, resultando em sua destabilização e morte e também por mecanismos intracelulares atingindo alvos-chave para a viabilidade celular. O potencial terapêutico dos PAMs de anuros é particularmente promissor diante do crescente problema da resistência bacteriana aos antibióticos tradicionais. A capacidade desses peptídeos de atuar de forma eficaz em patógenos resistentes faz deles uma alternativa interessante para o desenvolvimento de novos tratamentos. Além disso, estudos têm explorado suas propriedades imunomoduladoras e cicatrizantes, sugerindo aplicações em doenças infecciosas, na aceleração de processos de cura e em terapias para infecções virais emergentes, como a COVID-19. No presente trabalho, foi sintetizado por síntese química empregando-se a técnica Fmoc, uma raniseptina identificada a partir de uma biblioteca de cDNAs produzida da pele do anuro Boana albopuctata. Tal peptídeo, denominado raniseptina Ba-1, apresentou alta similaridade com as raniseptinas isoladas da espécie Boana raniceps. Em estudos de atividade antimicrobiana, mostrou-se capaz de inibir o crescimento de diversas bactérias patogênicas e de inibir a formação de biofilme da bactéria Pseudomonas aeruginosa. Exibiu efeitos citotóxicos em cultura de macrófagos RAW 264.7 na presença e na ausência de LPS e foi capaz de alterar a taxa de migração de neutrófilos. Em análises por dicroísmo circular, o peptídeo foi capaz de adotar conformação em a-hélice na presença de trifluoretanol e SDS. Em conclusão, a raniseptina Ba-1 exibiu atividade antimicrobiana e conformação em a-hélice, além de efeitos citotóxicos e imunomoduladores em culturas celulares, sugerindo seu potencial terapêutico como agente antimicrobiano.


  • Mostrar Abstract
  • Antimicrobial peptides (AMPs) are molecules present in the innate immune system of several organisms, including plants, insects and vertebrates, with direct action against pathogenic microorganisms, such as bacteria, fungi, protozoa and viruses, in addition to acting on tumor cells. Among the AMPs of greatest interest are those isolated from the secretion of anurans (frogs, toads and tree frogs), which have a broad spectrum of action and stand out for their therapeutic potential. These peptides, found in the cutaneous glands of anurans, act through mechanisms that involve direct interaction with the cell membranes of pathogens, resulting in their destabilization and death, and also through intracellular mechanisms reaching key targets for cell viability. The therapeutic potential of anuran AMPs is particularly promising given the growing problem of bacterial resistance to traditional antibiotics. The ability of these peptides to act effectively on resistant pathogens makes them an interesting alternative for the development of new treatments. Furthermore, studies have explored its immunomodulatory and healing properties, suggesting applications in infectious diseases, in accelerating healing processes and in therapies for emerging viral infections, such as COVID-19. In the present work, a raniseptin identified from a cDNA library produced from the skin of the anuran Boana albopuctata was synthesized by chemical synthesis using the Fmoc technique. This peptide, called raniseptin Ba-1, showed high similarity to raniseptins isolated from the species Boana raniceps. In assays of antimicrobial activity, it was shown to be capable of inhibiting the growth of several pathogenic bacteria and inhibiting the formation of biofilm by the bacterium Pseudomonas aeruginosa. It exhibited cytotoxic effects in RAW 264.7 macrophage cultures in the presence and absence of LPS and was able to alter the neutrophil migration rate. In circular dichroism analyses, the peptide was able to adopt an α-helical conformation in the presence of trifluoroethanol and SDS. In conclusion, raniseptin Ba-1 exhibited antimicrobial activity and α-helical conformation, as well as cytotoxic and immunomodulatory effects in cell cultures, suggesting its therapeutic potential as an antimicrobial agent.

Teses
1
  • Vanessa Nicolau de Lima
  • "DESENVOLVIMENTO DE UM PROTOCOLO DE FOTOHIPERTERMIA MEDIADA POR NANOPARTÍCULAS PARA PROMOÇÃO DE INFERTILIDADE DE ANIMAIS MACHOS".

  • Orientador : CAROLINA MADEIRA LUCCI
  • MEMBROS DA BANCA :
  • ALEXANDRE FLORIANI RAMOS
  • CAROLINA MADEIRA LUCCI
  • MARCIO BOTELHO DE CASTRO
  • MONICA PEREIRA GARCIA
  • PAULO CESAR DE MORAIS
  • Data: 01/03/2024

  • Mostrar Resumo
  • A superpopulação de animais errantes é um problema global, levantando preocupações sobre a reprodução descontrolada e riscos à saúde pública. A nanotecnologia oferece um potencial para castração através da fotohipertermia mediada por nanopartículas (FHT), mostrando-se promissora para o controle da população animal. O objetivo deste estudo foi avaliar o efeito da fotohipertermia testicular mediada por nanopartículas de maghemita recobertas com citrato e ouro (NPAu) e nanopartículas de ferrita de manganês funcionalizadas com citrato (NPCit) nos parâmetros reprodutivos de ratos Wistar. Foram utilizados no total 49 ratos Wistar (aproximadamente 10 semanas de idade). O tratamento por FHT foi realizado com a injeção intratesticular de 150 μL do fluido (NPAu ou NPCit) combinados com a irradiação de LED visando atingir a temperatura de aproximadamente 45 oC por 15 minutos. Avaliações de parâmetros reprodutivos foram feitas até 56 dias, tempo necessário para que ocorra a espermatogênese completa em ratos. Os resultados mostraram que a FHT testicular mediada pelas NPAu proporcionou danos progressivos a parâmetros reprodutivos dos animais, como: redução do volume testicular e redução da porcentagem de espermatozoides móveis, porcentagem de espermatozoides morfologicamente normais e número de espermatozoides na cauda dos epidídimos. Além disso, a avaliação histopatológica dos testículos aos 7, 28 e 56 dias após o tratamento revelou dano progressivo aos túbulos seminíferos. No entanto, túbulos seminíferos intactos ainda estavam presentes até o final das avaliações, sugerindo que o efeito não foi completo. A FHT testicular mediada pelas NPCit inicialmente mostrou resultados semelhantes aos obtidos com a NPAu, porém foi possível identificar que os túbulos seminíferos intactos estavam localizados na periferia dos testículos, mesmo com a presença de aglomerados de nanopartículas na região. Este achado sugeriu uma ineficiência na penetração da luz no tecido, que possivelmente não estava atingindo as nanopartículas do lado oposto à incidência do LED. Assim, um novo equipamento com 2 LEDs foi utilizado para a FHT mediada por NPCit, e os resultados mostraram uma destruição mais homogênea dos túbulos seminíferos. A análise histopatológica mostrou danos irreversíveis à espermatogênese, com agravamento progressivo com o passar do tempo. Além disso os parâmetros espermáticos e a morfometria testicular também foram afetados negativamente. Em todos os casos, independente da nanopartícula utilizada, não houve dor ou comprometimento do ganho de peso dos animais, e a histologia de fígado, baço, rim e pulmões não foi afetada pelo procedimento. Em conclusão, a aplicação de fotohipertermia mediada por nanopartículas (NPCit e NPAu) diretamente aos testículos resultou em efeitos prejudiciais importantes aos parâmetros reprodutivos de ratos em um período de curto prazo (56 dias), se mostrando um procedimento promissor para causar infertilidade em animais machos.


  • Mostrar Abstract
  • An overpopulation of stray animals is a global issue, raising concerns about uncontrolled reproduction and risks to public health. Nanotechnology presents potential for castration through nanoparticle-mediated photohyperthermia (NHT), showing promise for animal population control. The aim of this study was to assess the effect of testicular photohyperthermia mediated by maghemite nanoparticles coated with citrate and gold (NPAu) and citrate-functionalized manganese ferrite nanoparticles (NPCit) on the reproductive parameters of Wistar rats. A total of 49 Wistar rats (approximately 10 weeks old) were used. NHT treatment involved intratesticular injection of 150 μL of fluid (NPAu or NPCit) combined with LED irradiation to achieve a temperature of approximately 45°C for 15 minutes. Reproductive parameter evaluations were conducted up to 56 days, the time required for complete spermatogenesis in rats. Results indicated that testicular NHT mediated by NPAu led to progressive damage to reproductive parameters, including reduced testicular volume and percentages of motile and morphologically normal sperm, as well as the number of sperm in the epididymal tail. Additionally, histopathological evaluation of testicles at 7, 28, and 56 days posttreatment revealed progressive damage to seminiferous tubules. However, intact seminiferous tubules were still present at the end of the assessments, suggesting incomplete effects. Testicular NHT mediated by NPCit initially showed similar results to NPAu; however, it was identified that intact seminiferous tubules were located at the periphery of the testicles, even with the presence of nanoparticle clusters in the region. This finding suggested inefficient light penetration into the tissue, possibly not reaching nanoparticles on the opposite side of LED incidence. Therefore, a new device with 2 LEDs was used for NPCit-mediated NHT, and the results demonstrated more homogeneous destruction of seminiferous tubules. Histopathological analysis revealed irreversible damage to spermatogenesis, worsening progressively over time. Additionally, spermatic parameters and testicular morphometry were also negatively affected. In all cases, regardless of the nanoparticle used, there was no pain or compromised weight gain in the animals, and the histology of the liver, spleen, kidneys, and lungs was not affected by the procedure. In conclusion, the application of nanoparticle-mediated photohyperthermia (NPCit and NPAu) directly to the testicles resulted in significant harmful effects on the reproductive parameters of rats in a short-term period (56 days), proving to be a promising procedure for inducing infertility in male animals.

2
  • Alan Kelbis Oliveira Lima
  • “Fitossíntese de nanopartículas de prata (AgNPs) utilizando extrato aquoso de partes vegetais de guaraná (Paullinia cupana Kunth): estudo dos parâmetros reacionais, caracterização e atividades biológicas in vitro”.

     

  • Orientador : MONICA PEREIRA GARCIA
  • MEMBROS DA BANCA :
  • MONICA PEREIRA GARCIA
  • JOAO PAULO FIGUEIRO LONGO
  • LAISE RODRIGUES DE ANDRADE
  • GUSTAVO FRIGI PEROTTI
  • PATRICIA BENTO DA SILVA
  • Data: 07/03/2024

  • Mostrar Resumo
  • A síntese de nanopartículas de prata (AgNPs) por rotas mais seguras e com menor impacto ao meio ambiente é de grande interesse por abordar métodos biocompatíveis que podem aumentar a escala de produção e é útil também porque pode ser utilizada em substituição aos métodos químicos potencialmente tóxicos. Sendo denominada de “síntese verde”, essa rota utiliza organismos biológicos ou parte deles e que, devido à presença dos seus metabólitos, são capazes de reduzir os íons de prata (Ag+ ) e promover a estabilização da prata coloidal (Ag0 ). Dessa forma, esse estudo propôs a síntese verde de AgNPs utilizando extratos aquosos de guaraná (Paullinia cupana), uma planta nativa da Amazônia, investigando fatores como (i) a parte da planta utilizada, (ii) o modo de preparação dos extratos (iii) a época de coleta do material vegetal e (iv) os parâmetros envolvidos na síntese (concentração do extrato, do sal metálico, temperatura e equipamento/fonte de energia) que podem exercer influência sob as propriedades físico-químicas, bem como nos ensaios biológicos aos quais as nanoestruturas foram submetidas. Os extratos aquosos das folhas e flores de guaraná foram caracterizados quanto ao perfil fitoquímico revelando a presença de ácidos fenólicos, alcaloides e flavonoides como compostos majoritários, enquanto nos ensaios bioquímicos observou-se maiores teores de fenóis totais e capacidade de eliminação de radicais livres nas amostras preparadas por decocção. Em relação à parte da planta utilizada e avaliando a sazonalidade, os resultados demonstraram que as AgNPs com características desejáveis tinham diâmetros hidrodinâmicos entre 68,5 e 107,3 nm quando sintetizadas com extratos dos folíolos do período seco (AgNPs-PS) e chuvoso (AgNPs-PC), respectivamente e de 61,4 a 78,87 nm quando utilizado o extrato das flores (AgNPs-FL). A morfologia das AgNPs foi predominantemente esférica, com o potencial Zeta negativo para todas as amostras analisadas, alcançando cerca de –30 mV, o que indica boa estabilidade coloidal. As investigações realizadas a partir das alterações dos parâmetros reacionais envolvidos na síntese verde demonstrou a modulação na formação das AgNPs e em suas características físico-químicas, com os melhores rendimentos sob as condições otimizadas a partir da concentração de 2 mg/mL do extrato aquoso de folíolos da planta e 2 mM do sal metálico, temperatura de 70 ºC e com a síntese realizada em banho-maria. Quanto às bioatividades, as AgNPs exibiram ação antibacteriana contra cepas Gram-positivas e Gramnegativas. As AgNPs se destacaram quanto à capacidade antioxidante contra os radicais DPPH e ABTS de maneira dependente da dose, além de demonstrarem efeitos anticâncer diminuindo a viabilidade celular de linhagens tumorais de câncer de pele não melanoma e de pulmão, mesmo que de forma inespecífica já que tais efeitos também foram descritos para linhagens não tumorais. As AgNPs apresentaram ainda atividade catalítica com degradação do corante azul de metileno em 40 minutos e alaranjado de metila em até 14 minutos. Em relações aos testes inseticidas, os menores valores de CL50 e CL90 das AgNPs confirmaram sua eficácia contra larvas e pupas do Aedes aegypti em comparação à ação observada pela solução do sal metálico a partir de diferentes tempos de exposição. Em suma, a partir desses resultados, é possível inferir que os extratos aquosos de Paullinia cupana se apresentaram como fonte biológica para a síntese de AgNPs evidenciando assim uma contribuição ao desenvolvimento de estudos relacionados à modulação das características finais das nanoestruturas, bem como de suas aplicações em diversas áreas, mostrando novos potenciais para uso dessa espécie da biodiversidade brasileira.


  • Mostrar Abstract
  • The synthesis of silver nanoparticles (AgNPs) using safer routes with less impact on the environment is of great interest because it involves biocompatible methods that can increase the scale of production and is also useful because it can be used to replace potentially toxic chemical methods. Called as "green synthesis", this route uses biological organisms or parts of them which, due to the presence of their metabolites, can reduce silver ions (Ag+ ) and promoting the stabilization of colloidal silver (Ag0 ). Therefore, this study proposed the green synthesis of AgNPs using aqueous extracts of guarana (Paullinia cupana), a plant native to the Amazon, investigating factors such as (i) the part of the plant used, (ii) how the extracts were prepared (iii) when the plant material was collected and (iv) the parameters involved in the synthesis (concentration of the extract, (iv) the parameters involved in the synthesis (concentration of extract, metal salt, temperature and equipment/energy source) which may influence the physicochemical properties, as well as the biological tests to which the nanostructures were subjected. The aqueous extracts of guarana leaves and flowers were characterized in terms of their phytochemical profile, revealing the presence of phenolic acids, alkaloids, and flavonoids as the main compounds, while the biochemical tests showed higher levels of total phenols and free radical scavenging capacity in the samples prepared by decoction. Regarding the part of the plant used and evaluating seasonality, the results showed that the AgNPs with desirable characteristics had hydrodynamic diameters of between 68.5 and 107.3 nm when synthesized with extracts from the leaves of the dry period (AgNPs-PS) and the rainy period (AgNPs-PC), respectively, and from 61.4 to 78.87 nm when using the extract from the flowers (AgNPs-FL). The morphology of the AgNPs was predominantly spherical, with a negative Zeta potential for all the samples analyzed, reaching around -30 mV, which indicates good colloidal stability. The investigations carried out by changing the reaction parameters involved in the green synthesis showed modulation in the formation of AgNPs and their physicochemical characteristics, with the best yields under the conditions optimized from the concentration of 2 mg/mL of the aqueous extract and 2 mM of the metal salt, a temperature of 70 ºC and with the synthesis carried out in a water bath. In terms of bioactivities, AgNPs showed antibacterial action against Gram-positive and Gram-negative strains. The AgNPs stood out in terms of their antioxidant capacity against DPPH and ABTS radicals in a dose-dependent manner, as well as demonstrating anticancer effects by reducing the cell viability of non-melanoma skin cancer and lung cancer tumor cell lines, albeit in a non-specific manner, since these effects have also been described for non-tumor cell lines. The AgNPs also showed catalytic activity, degrading the dye methylene blue in 40 minutes and methyl orange in up to 14 minutes. In relation to the insecticide tests, the lower CL50 and CL90 values of the AgNPs confirmed their efficacy against Aedes aegypti larvae and pupae compared to the action observed with the metal salt solution at different exposure times. In short, based on these results, it is possible to infer that the aqueous extracts of Paullinia cupana were presented as a biological source for the synthesis of AgNPs, thus contributing to the development of studies related to the modulation of the final characteristics of nanostructures, as well as their applications in various areas, showing new potentials for the use of this species of Brazilian biodiversity.

3
  • Dileep Kumar
  • Low-Dose Chemotherapy Impact on Metastatic Breast Cancer: A Pre-clinical Study

  • Orientador : JOAO PAULO FIGUEIRO LONGO
  • MEMBROS DA BANCA :
  • JOAO PAULO FIGUEIRO LONGO
  • MONICA PEREIRA GARCIA
  • MARIA DE FATIMA MENEZES ALMEIDA SANTOS
  • Amanda Alencar Cabral Morais
  • Maria de Sousa Brito Neta
  • Data: 18/06/2024

  • Mostrar Resumo
  • O câncer de mama metastático é uma das principais causas de morbidade e mortalidade entre as mulheres em todo o mundo. Enquanto o câncer de mama em estágio inicial é frequentemente diagnosticado e tratado de forma eficaz, casos avançados e metastáticos apresentam desafios significativos. O tratamento para o câncer de mama metastático geralmente envolve uma combinação de cirurgia, radioterapia, quimioterapia, terapia hormonal e, mais recentemente, imunoterapia. Os objetivos principais são controlar a doença, aliviar os sintomas, prolongar a sobrevivência e melhorar a qualidade de vida do paciente. A escolha do tratamento depende de vários fatores, como o tipo de câncer de mama, o estágio da doença, a presença de receptores hormonais ou HER2, além das características individuais do paciente, e frequentemente evolui com base na resposta ao tratamento e na progressão da doença. Apesar dos tratamentos disponíveis, o câncer de mama metastático continua difícil de manejar e muitas vezes requer estratégias personalizadas. Pesquisadores buscam entender os mecanismos da metástase para desenvolver tratamentos mais eficazes. Um mecanismo chave envolve a imunossupressão, onde células tumorais proliferativas evitam a detecção imunológica. As células supressoras derivadas de mieloides (MDSC) desempenham um papel significativo nesse processo, suprimindo a resposta imune antitumoral e levando à resistência ao tratamento. Este estudo investiga os efeitos da quimioterapia em baixa dose (LDC) usando ciclofosfamida (CP) e 5-fluorouracil (5-FU) no microambiente tumoral e na resposta imunológica em um modelo préclínico de câncer de mama metastático. A hipótese é que a LDC pode reduzir as populações de MDSC, aprimorando a resposta imune antitumoral. O objetivo principal é avaliar os efeitos terapêuticos da LDC no câncer de mama metastático em camundongos. Objetivos específicos incluem avaliar o peso corporal e a sobrevivência geral, a progressão do tumor, a metástase pulmonar, o tamanho do baço e a população de MDSC. O estudo utilizou camundongos inoculados com células 4T1-luc, derivadas de um adenocarcinoma mamário murino. Os camundongos foram divididos em grupos de tratamento e controle, recebendo diferentes regimes de LDC com CP ou 5-FU. As avaliações incluíram peso corporal, sobrevivência, tamanho do tumor primário e imagens de bioluminescência. Amostras de baço, pulmão e sangue foram analisadas para histopatologia, imunofenotipagem e quantificação de populações de MDSC. Os resultados indicaram que a LDC foi bem tolerada, sem impacto significativo no peso corporal ou na sobrevivência. A LDC inibiu efetivamente o crescimento do tumor primário e reduziu a progressão da metástase pulmonar, especialmente com 5-FU. A análise histopatológica confirmou a ausência de metástases nos pulmões dos animais tratados. A LDC também reduziu as populações de MDSC, sugerindo um efeito imunomodulador. A análise hematológica mostrou mudanças nos parâmetros de leucócitos, indicando uma resposta imunológica ativa. Em resumo, a LDC demonstra potencial como um tratamento eficaz e bem tolerado para o câncer de mama metastático, com benefícios na inibição do crescimento tumoral e na modulação da resposta imunológica. Estes achados fornecem uma base para futuras pesquisas visando otimizar a LDC e explorar seu uso em outros tipos de câncer.


  • Mostrar Abstract
  • Metastatic breast cancer is a major cause of morbidity and mortality among women globally. While early-stage breast cancer is often diagnosed and treated effectively, advanced metastatic cases pose significant challenges. Treatment for metastatic breast cancer typically involves a combination of surgery, radiotherapy, chemotherapy, hormonal therapy, and immunotherapy. The primary goals are to control the disease, alleviate symptoms, prolong survival, and enhance the patient's quality of life. Treatment choice depends on cancer type, stage, hormone receptor status, HER2 presence, and individual patient factors, and it often evolves based on treatment response and disease progression. Despite available treatments, metastatic breast cancer remains difficult to manage and often requires personalized strategies. Researchers aim to understand the mechanisms of metastasis to develop more effective treatments. One key mechanism involves immunosuppression, where proliferating tumor cells evade immune detection. Myeloid Derived Suppressor Cells (MDSC) play a significant role in this process by suppressing the antitumor immune response, leading to treatment resistance. This study investigates the effects of low-dose chemotherapy (LDC) using cyclophosphamide (CP) and 5-fluorouracil (5-FU) on the tumor microenvironment and immune response in a preclinical metastatic breast cancer model. The hypothesis is that LDC can reduce MDSC populations, enhancing the antitumor immune response. The main objective is to evaluate LDC's therapeutic effects on metastatic breast cancer in mice. Specific objectives include assessing overall body weight and survival, tumor progression, lung metastasis, spleen size, and MDSC population. The study used mice inoculated with 4T1-luc cells, derived from a murine mammary adenocarcinoma. Mice were divided into treatment and control groups, receiving different LDC regimens with CP or 5-FU. Assessments included body weight, survival, primary tumor size, and bioluminescence imaging. Spleen, lung, and blood samples were analyzed for histopathology, immunophenotyping, and MDSC quantification. Results indicated that LDC was well-tolerated, with no significant impact on body weight or survival. LDC effectively inhibited primary tumor growth and reduced lung metastasis progression, particularly with 5-FU. Histopathological analysis confirmed the absence of metastases in treated animals' lungs. LDC also reduced MDSC populations, suggesting an immunomodulatory effect. Hematological analysis showed changes in leukocyte parameters, indicating an active immune response. In summary, LDC demonstrates potential as an effective and well-tolerated treatment for metastatic breast cancer, with benefits in inhibiting tumor growth and modulating the immune response. These findings provide a foundation for further research to optimize LDC and explore its use in other cancers.

4
  • José Athayde Vasconcelos Morais
  • Avaliação da atividade imunogênica da terapia fotodinâmica mediada por nanoemulsão de alumínio-ftalocianina em modelo de melanoma murino B16F10.

  • Orientador : MARCIO JOSE POCAS FONSECA
  • MEMBROS DA BANCA :
  • MARCIO JOSE POCAS FONSECA
  • ROLANDO ANDRE RIOS VILLACIS
  • ANA PAULA JUNQUEIRA KIPNIS
  • ITAJAÍ OLIVEIRA DE ALBUQUERQUE
  • Maria de Sousa Brito Neta
  • Data: 12/07/2024

  • Mostrar Resumo
  • O melanoma, a forma mais letal de câncer de pele, representa um grande desafio clínico devido à sua tendência à formação de metástases e à sua resistência às terapias tradicionais. Apesar dos avanços na cirurgia, quimioterapia e radioterapia, o tratamento do melanoma avançado ainda carece de alternativas mais eficazes, reforçando a necessidade urgente de mais estudos nessa área. A terapia fotodinâmica (TFD) surgiu há mais de um século como uma alternativa promissora ao tratamento de cânceres. Esse tratamento é baseado na fotoativação de um fotossensibilizante, o qual então converte oxigênio e outras moléculas presentes no tecido alvo a espécies altamente oxidantes, as quais danificam diversas biomoléculas e podem provocar a morte de células afetadas. A eficácia antitumoral da TFD depende de três mecanismos principais: i) citotoxicidade direta às células alvo, ii) colapso da microvasculatura tumoral, com consequente isquemia tecidual, e iii) ativação de respostas imunitárias contra as células tratadas. Ainda, a fotocitotoxicidade desta terapia é limitada aos tecidos irradiados por luz na sua aplicação, reduzindo a probabilidade de ocorrência de efeitos colaterais negativos. Em nosso estudo, exploramos os efeitos antitumorais da TFD mediada pelo fotossensibilizante cloreto de alumínio-ftalocianina em modelos de melanoma murino de células B16F10, destacando sua participação na indução de morte celular imunogênica, efeito abscopal e na imunomodulação pela alteração de expressão de genes responsáveis pelo processo do sistema imunitário. Esta pesquisa lança luz sobre o potencial de diferentes protocolos de TFD para modular as respostas imunes e abre caminhos para tratamentos de câncer mais eficazes e direcionados.


  • Mostrar Abstract
  • Melanoma, the most lethal form of skin cancer, presents a significant clinical challenge due to its propensity for metastasis and resistance to traditional therapies. Despite advances in surgery, chemotherapy, and radiotherapy, the treatment of advanced melanoma still lacks more effective alternatives, underscoring the urgent need for further research in this area. Photodynamic therapy (PDT), which emerged over a century ago, has shown promise as an alternative cancer treatment. This therapy relies on the photoactivation of a photosensitizer, which then converts oxygen and other molecules present in the target tissue into highly oxidizing species that damage various biomolecules and can induce the death of affected cells. The antitumor efficacy of PDT depends on three main mechanisms: i) direct cytotoxicity to target cells, ii) collapse of the tumor microvasculature, leading to tissue ischemia, and iii) activation of immune responses against treated cells. Additionally, the phototoxicity of this therapy is limited to tissues irradiated by light during its application, reducing the likelihood of adverse side effects. In our study, we explored the antitumor effects of PDT mediated by the photosensitizer aluminum phthalocyanine chloride in murine B16F10 melanoma models, highlighting its role in inducing immunogenic cell death, the abscopal effect, and immunomodulation by altering the expression of genes responsible for immune system processes. This research sheds light on the potential of different PDT protocols to modulate immune responses and paves the way for more effective and targeted cancer treatments.

5
  • Valêska Kouzak Campos da Paz
  • EFEITOS DO TREINO DE NEUROFEEDBACK SOBRE ASPECTOS COGNITIVOS E MOTORES EM PACIENTES COM DOENÇA DE PARKINSON NOS ESTÁGIOS INICIAIS”.

  • Orientador : MARIA CLOTILDE HENRIQUES TAVARES
  • MEMBROS DA BANCA :
  • ANA CLAUDIA OLIVEIRA GARCIA DOS SANTOS
  • CORINA ELIZABETH SATLER
  • JOAQUIM PEREIRA BRASIL NETO
  • MARIA CLOTILDE HENRIQUES TAVARES
  • RAPHAEL BOECHAT BARROS
  • Data: 19/08/2024

  • Mostrar Resumo
  • A doença de Parkinson (DP) é um quadro degenerativo do Sistema Nervoso Central, que apresenta sintomas motores como tremor de repouso, bradicinesia, rigidez muscular, e não motores como anosmia, sintomas neuropsiquiátricos e perdas neuropsicológicas. É a segunda doença degenerativa mais comum no mundo, de maneira que milhões de pessoas são acometidas na idade adulta e idosa por essa patologia. O Neurofeedback (NFB) é uma ferramenta psicofisiológica cujo principal objetivo é propiciar ao indivíduo a autorregulação de sua atividade cerebral, utilizando para isso, alguns instrumentos que fornecem dados cerebrais para o sujeito. No presente estudo utilizamos o NFB de eletroencefalograma (EEG) sobre a área sensório motora para incrementar a atividade do Ritmo Sensório Motor (12-15 hz), uma vez que essa faixa de frequência está relacionada à regulação motora em indivíduos com hiperatividade e melhoras atencionais. Foram realizadas 10 sessões de NFB em 8 sujeitos com DP em estágios iniciais, sendo 6 homens com média de idade de 65,25 anos (DP±5,75). Os sujeitos foram distribuídos em três grupos: um experimental (NFB) que realizou as sessões de NFB, outro controle placebo (SNFB), que realizou sessões de falso NFB e um controle (Non-NFB) que permaneceu numa lista de espera pelo período de treino, aproximadamente 1 mês e meio, os sujeitos do Non-NFB foram alocados depois nos grupos: Experimental (NFB) ou controle (S-NFB). Todos os sujeitos realizaram um rastreio neuropsicológico, emocional, avaliação motora global e uma tarefa de função motora fina, o Sequential Finger Tapping Task - SEQTAP, antes e depois das sessões de NFB com o objetivo de verificar possíveis mudanças motoras após o treino. Os resultados indicaram que não ocorreram mudanças motoras estatisticamente significativas nos testes utilizados para nenhum dos grupos do estudo, bem como não houve mudanças no teste SEQTAP que avalia a função motora fina. Entretanto, os resultados da avaliação de ansiedade, depressão e cognição foram estatisticamente significativos para os sujeitos que realizaram o NFB em comparação ao sujeito com ele mesmo antes e depois do período de treino. O grupo controle placebo demonstrou diferença estatisticamente significativa no teste cognitivo, e o grupo controle sem NFB não demonstrou mudanças estatisticamente significativas em relação a nenhum dos testes aplicados. Esses resultados demonstram que o NFB pode ser uma ferramenta para melhora dos aspectos emocionais e cognitivos de pacientes com Parkinson, mesmo não modificando a função motora.


  • Mostrar Abstract
  • Parkinson Disease (PD) is a degenerative disease of the Central Nervous System that presents motor symptoms such as resting tremor, bradykinesia, muscular rigidity, and nonmotor symptoms such as anosmia, neuropsychiatric alterations and neurocognitive loss. Is the second most common degenerative disease in the world, so that millions of people are compromised in adulthood and old age for this pathology. The neurofeedback (NFB) is a psychophysiological tool that the main objective is to provide to individuals self-regulation of his brain activity, using instruments that offer brain information to the subject. In the present study we applied the Electroencephalogram (EEG) NBF over the sensorimotor region to increment the sensorimotor rhythm (12-15Hz), once this frequency range is associated with motor regulation of hyperactive individuals and improve attention. It was conducted 10 sessions of NFB in 8 PD patients, 6 males, with the mean age of 65,25 (SD ±5,75) randomly distributed in three groups: Experimental (NFB) which did the NFB training, a control Sham neurofeedback group (S-NFB) and a group that did not have NFB training (Non-NFB) for the period equivalent to 10 sessions, that is, 5 weeks. Afterwards, the Non-NFB did all the tests again and was allocated to one of the groups NFB or S-NFB. All subjects did a neuropsychological, emotion, motor screening and a fine motor task, Sequential Finger Tapping Task- SEQTAP, before and after the NFB sessions with the objective to verify possible changes in motor condition after training. The results have demonstrated that there was not statistically difference between subjects in the motor tests, however, in non-motor symptoms such as anxiety (p<0.05), depression (p<0.05) and cognition (p<0,05) have changed significantly to subjects that did the neurofeedback training. The placebo control group also has significantly modified their results in cognitive tests and the control group that did not make the NFB training have not modified significantly. These results indicate that NFB might be a tool to improve emotional and cognitive aspects in PD patients, even not modifying motor function.

6
  • Samara de Albuquerque Teixeira
  • Fisiologia, ecologia e conservação de macacos-prego-amarelos (Sapajus libidinosus) no Parque Nacional de Brasília

  • Orientador : TORBJORN HAUGAASEN
  • MEMBROS DA BANCA :
  • TORBJORN HAUGAASEN
  • FRANCISCO DYONISIO CARDOSO MENDES
  • ADRIAN PAUL ASHTON BARNETT
  • LAURENCE MARIANNE VINCIANNE CULOT
  • MAÍRA BENCHIMOL DE SOUZA
  • Data: 20/09/2024

  • Mostrar Resumo
  • Os primatas são um componente integral da fauna de muitas florestas tropicais e são importantes para o funcionamento dos ecossistemas, por exemplo, por meio da dispersão de sementes. No entanto, o seu bem-estar e função no ecossistema podem ser afetados pela proximidade ou pelas interações com os seres humanos. Informações sobre fisiologia, comportamento alimentar e conscientização entre a população local são, portanto, importantes para fins de conservação. Para o trabalho apresentado nesta tese, habituei um grupo de macacos-prego (Sapajus libidinosus) que estão em contato regular com humanos no Parque Nacional de Brasília (PNB) e tive como objetivos: (1) caracterizar os níveis de estresse dos macacos-prego por meio da análise de cortisol fecal; (2) caracterizar a composição da dieta do macaco-prego, quantificar o número de sementes ingeridas e analisar o tempo e o sucesso de germinação entre sementes ingeridas e sementes frescas de árvores locais; e (3) conscientizar os visitantes sobre os macacos-prego por meio de atividades educativas. Os dados foram coletados por meio de observações focais e ad libitum de cada indivíduo do grupo (n = 9) durante um período de 8 meses. Coletei 125 amostras fecais para análise de cortisol e 139 amostras para testes de dieta e germinação de sementes. As atividades educativas foram realizadas durante 2 meses. Entre elas, um vídeo educativo, distribuição de materiais educativos, jogos interativos e trilhas ecológicas que consistiam em caminhadas guiadas duas vezes ao dia, nas quais eram destacadas características do bioma Cerrado e dos macacos-prego. Os primatas passavam a maior parte do tempo em comportamentos de alimentação (32,8%) e forrageamento (32,63%). Os níveis de cortisol foram afetados pelo número de comportamentos agonísticos em que os indivíduos estavam envolvidos. Os alimentos antropogênicos oferecidos/roubados pelos visitantes representaram 20% de sua dieta e podem ter afetado o número de interações agonísticas dentro do grupo. Esses alimentos são ricos em açúcar e calorias o que os torna muito apreciados pelos primatas, estimulando assim a competição entre os indivíduos. O alimento mais consumido pelos primatas foram os frutos (55%) e a dieta era composta por 33 espécies vegetais de 21 famílias diferentes. Nos testes de germinação, as sementes plantadas com fezes germinaram mais rapidamente, sugerindo que passar pelo intestino do primata e ser depositado com material fecal auxilia a germinação das sementes. A emergência mais rápida das plântulas pode ter um efeito positivo na sobrevivência e no crescimento das plantas. Os resultados também mostraram que os macacos-prego são importantes dispersores de sementes de tamanho médio e grande que podem ser inacessíveis aos frugívoros menores e, portanto, desempenham um papel importante na manutenção e conservação do Cerrado no PNB. Registramos 396 visualizações do vídeo educativo, 1273 jogos foram utilizados pelas crianças e, estima-se que 183 pessoas participaram das caminhadas guiadas. Ao enfatizar o importante papel que os primatas desempenham na natureza e ao destacar os potenciais perigos das interações entre humanos e primatas, podem ser evitadas informações imprecisas e promovida uma coexistência mais harmoniosa. No entanto, por ora, a dieta e a saúde do grupo são afetadas pelos alimentos fornecidos pelos visitantes do parque, sugerindo que é altamente recomendável restringir a alimentação no parque ou fornecer uma área de refeições fechada para os visitantes. A implementação de tais medidas preventivas e ações educativas parece ser crucial para evitar a perda da função ecológica desta espécie e para conservar a biodiversidade dentro do parque.


  • Mostrar Abstract
  • Primates are an integral faunal component of many tropical forests and are important for ecosystem functioning, for example through seed dispersal. However, their well-being and function in the ecosystem may be affected by the proximity of, or interactions with, humans. Information on physiology, feeding behavior and awareness among local people are therefore important for conservation purposes. For the work presented in this thesis, I habituated a group of bearded capuchin monkeys (Sapajus libidinosus) that are in regular contact with humans in Brasilia National Park (BNP) and aimed to: (1) characterize capuchin stress levels through the analysis of fecal cortisol; (2) characterize capuchin diet composition, quantify the number of seeds ingested and examine germination time and success between ingested seeds and fresh seeds from local trees; and (3) raise awareness among visitors regarding capuchin monkeys through educational activities. Data were collected via focal and ad libitum observations of each group individual (n = 9) during an 8-month period. I collected 125 fecal samples for cortisol analysis and 139 samples for diet and seed germination trials. Educational activities were carried out for 2 months. These included an educational video, distribution of educational materials, interactive games and ecological trails that consisted of guided walks twice a day, during which characteristics of the Cerrado biome and capuchin monkeys were highlighted. Primates spent most of their time in feeding (32.8%) and foraging (32.63%) behaviors. Cortisol levels were affected by the number of agonistic behaviors in which individuals were involved. Anthropogenic foods offered/stolen by visitors made up 20% of their diet and may have affected the number of agonistic interactions within the group. These foods are rich in sugar and high in calories which makes them highly appreciated by primates, thus encouraging competition between individuals. The food item most consumed by primates was fruits (55%) and the diet consisted of 33 plant species from 21 different families. Seeds planted with feces in the germination trials germinated faster, suggesting that passing through the primate gut and being deposited with fecal material improves seed germination. The faster emergence of seedlings may have a positive effect for plant survival and growth. Results also showed that bearded capuchins are important dispersers of medium and large seeds that may be inaccessible to smaller frugivores and they therefore play an important role in the maintenance and conservation of the Cerrado in BNP. We recorded 396 views for the educational video and 1273 games were used by the children. An estimated 183 people participated on the guided walks. By emphasizing the important role primates play in nature and highlighting the potential dangers of interactions between humans and primates, inaccurate information can be avoided and a more harmonious coexistence promoted. However, for now, diet and group health are affected by food provisioned by park visitors, suggesting that restricting food in the park or providing an enclosed dining area for visitors is highly recommended. The implementation of such preventive measures and educational actions appears to be crucial to avoid losing the ecological function of this species and conserve biodiversity within the park.

2023
Dissertações
1
  • JOYCE SILVA DOS SANTOS
  • Caracterização das propriedades biológicas de uma dermaseptina isolada da secreção cutânea de Pithecopus rohdei (Anura: Phyllomedusidae)

  • Orientador : MARIANA DE SOUZA CASTRO
  • MEMBROS DA BANCA :
  • MARIANA DE SOUZA CASTRO
  • OSMINDO RODRIGUES PIRES JUNIOR
  • CARLOS ANDRE ORNELAS RICART
  • MARLON HENRIQUE E SILVA CARDOSO
  • Data: 10/04/2023

  • Mostrar Resumo
  • O uso indiscriminado de antibióticos tem provocado elevados níveis de resistência bacteriana ao redor do mundo. Esse cenário se intensificou significativamente após o período pandêmico de SARS- COV 2, onde agentes antimicrobianos foram utilizados desenfreada e erroneamente, mesmo que indicados apenas no caso de confeição com bactérias ou fungos. Com isso, ocorreu um aumento expressivo de superbactérias resistentes, levando à necessidade do uso de antibióticos de alto espectro e graves efeitos colaterais, como é o caso da Polimixina B, um medicamento associado a intensa nefrotoxicidade e uma das últimas alternativas de tratamento para superbactérias hospitalares. Diante disso, pesquisas envolvendo moléculas com potencial antimicrobiano são de grande importância para a sociedade e tem ganhado espaço no meio científico. Uma interessante opção para esse quadro é o estudo de moléculas antimicrobianas naturais, como é o caso dos peptídeos antimicrobianos (PAMs) também chamados de peptídeos de defesa do hospedeiro (PDHs). Esses peptídeos são moléculas curtas, catiônicas, anfipáticas e abundantes na natureza, sendo muito encontrados na secreção cutânea de anfíbios. Nesse trabalho, foi isolado um potente peptídeo antimicrobiano presente na secreção cutânea de Pithecopus rohdeii, uma espécie da família Phylomedusidae. A fração ativa foi isolada por cromatografia líquida de alta eficiência e apresentou uma massa de 3080,66 Da. A molécula foi sequenciada por degradação de Edman e apresentou uma sequência peptídica de 30 resíduos de aminoácidos (GLWKMLAKGAGKVLGHVASKFLGSQGQPES-COOH). Por estudos de similaridade de sequência, foi observado que esse peptídeo possui alta similaridade de sequência com peptídeos da classe das dermaseptinas, sendo então denominado Dermaseptina PR-1 (PR em referência à espécie Pithecopus rohdei). Através de análises de dicroísmo celular (DC), a estrutura secundária do peptídeo na presença de SDS e TFE foi avaliada, sendo possível inferir que a Dermaseptina PR-1 forma uma estrutura em alfa-hélice quando em contato com as membranas, um padrão associado à respostas antimicrobianas em outros peptídeos de defesa. No que diz respeito a testes biológicos, o peptídeo apresentou resultados inibitórios no crescimento das bactérias Grampositivas Staphylococcus aureus (CIM = 4 M), Staphylococcus epidermidis (CIM = 4 M) e Enterococcus faecalis (CIM = 16 M) e Gram-negativas Escherichia coli (CIM = 1 M), Klebsiella pneumoniae (CIM = 2 M) e Pseudomonas aeruginosa (CIM = 4 M), sendo observado, também, a atividade antibacteriana em um isolado clínico multirresistente de Klebsiella pneumoniae carbapenemase, resultado que foi corroborado por teste de microscopia eletrônica de varredura(MEV) onde se pôde observar a formação de poros e profundas rugosidades na membrana dessa bactéria, que leva a desestruturação da parede e lise do microrganismo. Além disso, como um teste preliminar para avaliar a capacidade inunomodulatória dessa dermaseptina, o peptídeo foi testado quanto a sua capacidade de induzir a quimiotaxia de neutrófilos, onde se observou uma moderada atividade quimiotática. Esses resultados sugerem que o peptídeo pode atuar de forma dupla, erradicando bactérias de maneira direta e indireta. Por fim, a atividade hemolítica do peptídeo foi avaliada e resultou em um baixo percentual de hemólise nas concentrações relacionadas aos valores de CIMs de bactérias sensíveis (2% a 9% ) observando-se também uma moderada atividade hemolítica na concentração inibitória da superbactéria Klebsiella pneumoniae carbapenemase (23%).


  • Mostrar Abstract
  • The indiscriminate use of antibiotics has caused high levels of bacterial resistance around the world. This scenario intensified significantly after the SARS-COV 2 pandemic period, where antimicrobial agents were wildly and erroneously used, even if indicated only in the case of confection with bacteria or fungi. As a result, there was a significant increase in resistant superbugs, leading to the need for the use of high-spectrum antibiotics and serious side effects, such as Polymyxin B, one of the last treatment alternatives for hospital superbugs associated with intense nephrotoxicity. In view of this, research involving molecules with antimicrobial potential is of great importance to society and has gained space in the scientific community. An interesting option for this scenario is the study of natural antimicrobial molecules, such as antimicrobial peptides (AMPs) also called host defense peptides (PDH's). These peptides are short molecules, cationic, amphipathic and abundant in nature, being often found in the cutaneous secretion of amphibians. In this work, a potent antimicrobial peptide present in the cutaneous secretion of Pithecopus rohdei, a species of the Phylomedusidae family, was isolated. The active fraction was identified by High Performance Liquid Chromatography and had a mass of 3080.66 Da. The molecule was sequenced by Edman degradation and presented a peptide sequence of 30 amino acid residues (GLWKMLAKGAGKVLGHVASKFLGSQGQPES-COOH). of Dermaseptin Pr-1 (Pr in reference to the species Pithecopus rohdei). Through the cellular dichroism (DC) test, the secondary structure of the peptide in the presence of SDS and TFE was evaluated, making it possible to infer that dermaseptin Pr-1 forms an alpha helix structure when in contact with membranes, a pattern associated with antimicrobial responses in other defense peptides. With regard to biological tests, the peptide showed inhibitory results on the growth of Gram-positive bacteria Staphylococcus aureus (MIC = 4 M), Staphylococcus epidermidis (MIC = 4 M) e Enterococcus faecalis (MIC = 16 M) and Gram-negative Escherichia coli (MIC = 1 M), Klebsiella pneumoniae (MIC = 2 M) e Pseudomonas aeruginosa (MIC = 4 M), and antibacterial activity was also observed in a multiresistant clinical isolate of Klebsiella pneumoniae Carbapenemase, a result that was corroborated by scanning electron microscopy (SEM) test where it was possible to observe the formation of pores and deep roughness in the membrane of this bacterium, which leads to disruption of the wall and lysis of the microorganism. Furthermore, as a preliminary test to evaluate the immunomodulatory capacity of this dermaseptin, the peptide was tested for its ability to induce neutrophil chemotaxis, where a moderate chemotactic activity was observed. These results suggest that the peptide can act in a dual way, eradicating bacteria directly and indirectly. Finally, the hemolytic activity of the peptide was evaluated and resulted in a low percentage of hemolysis in the concentrations related to the MICs of sensitive bacteria (2% to 9%) also observing a moderate hemolytic activity in the inhibitory concentration of the superbug Klebsiella pneumoniae carbapenemase (23%).

2
  • LEONARDO MACIEL CUNHA
  • Avaliação dos efeitos biológicos de análogos de segunda geração do peptídeo antimicrobiano ocellatin 4

  • Orientador : MARIANA DE SOUZA CASTRO
  • MEMBROS DA BANCA :
  • CARLOS ANDRE ORNELAS RICART
  • CONSUELO MEDEIROS RODRIGUES DE LIMA
  • DANIELA MARA DE OLIVEIRA
  • Vivian Vasconcelos Costa Litwinski
  • Data: 11/04/2023

  • Mostrar Resumo
  • As secreções cutâneas de anuros são uma rica fonte de peptídeos bioativos, sendo que diversos desses peptídeos exibem atividade antimicrobiana, fato muito relevante diante do atual cenário de multirresistência das bactérias aos antibióticos comercialmente disponíveis. Assim, a busca por novas opções terapêuticas para enfrentar a atual crise dos antibióticos torna-se premente e uma estratégia para o desenvolvimento de novas drogas anti-infecciosas reside no desenho racional de análogos de peptídeos antimicrobianos identificados na natureza. O presente trabalho teve como objetivo geral avaliar os efeitos biológicos de análogos de segunda geração do peptídeo antimicrobiano K[1,4,8,15];A[12,16,20], um análogo do peptídeo antimicrobiano ocellatin 4. Com o emprego da síntese química em fase sólida foram produzidos o peptídeo template e seus análogos. De posse dos peptídeos sintéticos foram realizados ensaios de microdiluição seriada para se avaliar suas propriedades antimicrobianas sobre bactérias de interesse médico Gram-positivas e Gram-negativas e do fungo Candida albicans. Também foram avaliados seus efeitos sobre células eucarióticas: eritrócitos humanos e células de melanoma murino B16F10. Ensaios para avaliação de efeitos na proliferação do vírus SARS-COV-2 e sobre a migração de neutrófilos humanos foram realizados. K[1,4,8,15];A[12,16,20] demonstrou atividade antibacteriana variada e alguns dos análogos testados exibiram potência aumentada, o mesmo pode ser dito quanto á atividade sobre células de melanoma murino da linhagem B16F10 e sobre a migração de neutrófilos. Alguns dos análogos testados merecem destaque e necessitam de estudos subsequentes principalmente para reduzir sua atividade hemolítica. Um dos análogos demonstra grande potencial terapêutico e não apresentou toxicidade, mais testes adicionais precisam ser realizados de modo a avaliar com maior profundidade suas propriedades anti-infecciosas e anti-câncer.


  • Mostrar Abstract
  • Anuran skin secretions are a rich source of bioactive peptides, and several of these peptides exhibit antimicrobial activity, a very relevant fact in view of the current scenario of multidrug resistance of bacteria to commercially available antibiotics. Thus, the search for new therapeutic options to face the current antibiotic crisis becomes urgent and a strategy for the development of new anti-infective drugs lies in the rational design of analogues of antimicrobial peptides identified in nature. The general objective of this work was to evaluate the biological effects of second-generation analogues of the antimicrobial peptide K[1,4,8,15];A[12,16,20], an analogue of ocelatine 4. With the use of the synthesis Solid phase chemistry produced the template peptide and its analogues. With the synthetic peptides in hand, serial microdilution assays were carried out to evaluate their antimicrobial properties on Gram-positive and Gram-negative bacteria of medical interest and the fungus Candida albicans. Its effects on eukaryotic cells were also evaluated: human erythrocytes and B16F10 murine melanoma cells. Assays to evaluate the effects on the proliferation of the SARS-COV-2 virus and on the migration of human neutrophils were performed. K[1,4,8,15];A[12,16,20] demonstrated varied antibacterial activity and some of the tested analogues exhibited increased potency, the same can be said for activity on murine melanoma cells of the B16F10 lineage and on the migration of neutrophils. Some of the analogues tested are noteworthy and require further studies, mainly to reduce their hemolytic activity. One of the analogues demonstrates great therapeutic potential and did not present toxicity, but additional tests need to be performed in order to evaluate in greater depth its anti-infective and anti-cancer properties.

3
  • RAYANE BRANDÃO RIBEIRO
  • " Comparação de métodos de criopreservação em tecido ovariano de gatas domésticas: vitrificação versus congelamento lento ".

  • Orientador : FERNANDA PAULINI
  • MEMBROS DA BANCA :
  • ANA LUIZA SILVA GUIMARAES
  • DANIELA MARA DE OLIVEIRA
  • FERNANDA PAULINI
  • MICHELLE SILVA ARAUJO
  • Data: 24/07/2023

  • Mostrar Resumo
  • O presente estudo testou duas técnicas de criopreservação (vitrificação e congelamento lento) com combinações diferentes de crioprotetores. Para realizar o estudo, foram utilizados os ovários de 10 gatas submetidas a ovariohisterectomia eletiva na clínica veterinária Casa do Gato, localizada em Brasília, DF. No total, foram coletados 20 ovários, cada um dos quais foi dividido em oito fragmentos de 3mm³. Dois fragmentos de cada ovário foram imediatamente fixados para o controle fresco, enquanto os outros seis foram divididos em três para serem vitrificados e três para serem criopreservados por congelamento lento. Para o processo de vitrificação, diferentes soluções de equilíbrio (SE) e de vitrificação (SV) foram testadas. Essas soluções incluíam 10% de dimetilsulfóxido (DMSO) associado a 10% de etilenoglicol (EG) e combinado com 0,1M de trealose no SE, e 20% de DMSO e 20% de EG com 0,1M de trealose no SV (V1). Outra solução consistiu em 10% de DMSO associado a 10% de EG e combinado com 0,1M de sacarose no SE, e 20% de DMSO e 20% de EG com 0,1M de sacarose no SV (V2). Uma terceira solução foi composta por 20% de DMSO combinado com 0,1M de trealose no SE e 40% de DMSO combinado com 0,1M de trealose no SV (V3). Para a congelamento lento, as soluções consistiram em 1M de DMSO, 1M de EG e 10% soro fetal bovino (SFB) combinados à 0,4% trealose (CL1), 1,5 M de DMSO e 10% SFB combinados com 0,4% sacarose (CL2) ou 0,4% trealose (CL3). Todas as amostras foram armazenadas em nitrogênio líquido durante pelo menos sete dias e os fragmentos foram descongelados ou desvitrificados e fixados após esse período. Foram realizadas análises histológicas para a contagem e classificação de folículos pré-antrais e testes imunohistoquímicos para avaliar se os folículos estavam proliferativos. O grupo V1, teve a maior taxa de preservação da reserva folicular primordial e de folículos em crescimento e mostrou ser a mais eficaz na sobrevivência folicular. Assim, é possível inferir que a vitrificação com uso de 10% DMSO, 10% EG e 0,1M trealose mostrou efeitos benéficos, mas estudos futuros são necessários para maior comprovação da eficácia dos protocolos apresentados.


  • Mostrar Abstract
  • The present study tested two cryopreservation techniques (vitrification and slow freezing) with different combinations of cryoprotectants. To perform the study, ovaries from 10 female cats submitted to elective ovariohysterectomy at Casa do Gato veterinary clinic, located in Brasília, DF, Brazil, were used. In total, 20 ovaries were collected, each of which was divided into eight 3mm³ fragments. Two fragments of each ovary were immediately fixed for fresh control, while the other six were divided into three to be vitrified and three to be cryopreserved by slow freezing. For the vitrification process, different equilibration (SE) and vitrification (SV) solutions were tested. These solutions included 10% dimethyl sulfoxide (DMSO) associated with 10% ethylene glycol (EG) and combined with 0.1M trehalose in the SE, and 20% DMSO and 20% EG with 0.1M trehalose in the SV (V1). Another solution consisted of 10% DMSO coupled with 10% EG and combined with 0.1M sucrose in SE, and 20% DMSO and 20% EG with 0.1M sucrose in SV (V2). A third solution was composed of 20% DMSO combined with 0.1M trehalose in SE and 40% DMSO combined with 0.1M trehalose in SV (V3). For slow freezing, the solutions consisted of 1M DMSO, 1M EG and 10% fetal bovine serum (FBS) combined with 0.4% trehalose (CL1), 1.5 M DMSO and 10% SFB combined with 0.4% sucrose (CL2) or 0.4% trehalose (CL3). All samples were stored in liquid nitrogen for at least seven days and the fragments were thawed or devitrified and fixed after this period. Histological analyses were performed to count and classify preantral follicles and immunohistochemical tests were performed to assess whether the follicles were proliferative. Group V1, had the highest rate of preservation of primordial follicle reserve and growing follicles and was shown to be the most effective in follicle survival. Thus, it can be inferred that vitrification using 10% DMSO, 10% EG and 0.1M trehalose showed beneficial effects, but future studies are needed for further proof of the effectiveness of the protocols presented.

4
  • Julia Santoucy Barros
  • "Dosagem de esteroides sexuais e cortisol fecais e observação de comportamento em fêmeas de felideos selvagens mantidas sob cuidados humanos ".

  • Orientador : CAROLINA MADEIRA LUCCI
  • MEMBROS DA BANCA :
  • CAROLINA MADEIRA LUCCI
  • ALEXANDRE RODRIGUES SILVA
  • ELLEN CRISTINA RIVAS LEONEL
  • MARGOT ALVES NUNES DODE
  • Data: 31/07/2023

  • Mostrar Resumo
  • O presente estudo avaliou 4 fêmeas de felinos selvagens residentes do Jardim Zoológico de Brasília, sendo duas sussuaranas (Puma concolor), uma gata do mato pequena (Leopardus tigrinus) e uma jaguarundi (Puma yagouaroundi). Estas fêmeas tiveram o comportamento observado diariamente por um período de aproximadamente 4 meses, durante o qual foram também coletadas amostras de fezes para dosagem de metabólitos de hormônios esteroides (estrógeno, progesterona e cortisol). Os dados obtidos descrevem eventos relacionados à fisiologia reprodutiva destas fêmeas, correlacionando o comportamento com as dosagens hormonais, bem como aspectos relacionados a estresse. Este trabalho fornece informações a respeito destas três espécies de felinos nativas da fauna brasileira, contribuindo para o pouco conhecimento disponível a respeito de espécies de felinos selvagens mantidos sob cuidados humanos.


  • Mostrar Abstract
  • The present study evaluated 4 wild feline females residing at the Jardim Zoológico de Brasília, two Pumas (Puma concolor), a Northern Tiger Cat (Leopardus tigrinus) and a jaguarundi (Puma yagouaroundi). These females had their behavior observed daily for a period of approximately 4 months, during which feces samples were also collected for dosage of steroid hormone metabolites (estrogen, progesterone and cortisol). The obtained data describe events related to the reproductive physiology of these females, correlating the behavior with the hormonal dosages, as well as aspects related to stress. This work provides information about these three species of wild cats native to the Brazilian fauna, contributing to the little knowledge available about species of wild cats kept under human care.

5
  • NATANAEL SALES SILVA
  • PEPTÍDEOS ANTIMICROBIANOS PENTADACTILINA E FALAXINA: AVALIAÇÃO DOS EFEITOS SINÉRGICOS COM POLIMIXINA B SOBRE Klebsiella pneumoniae CARBAPENEMASE E DOS EFEITOS IMUNOMODULATÓRIOS SOBRE NEUTRÓFILOS HUMANOS.

  • Orientador : MARIANA DE SOUZA CASTRO
  • MEMBROS DA BANCA :
  • LUCAS SILVA DE OLIVEIRA
  • MARCELO HENRIQUE SOLLER RAMADA
  • MARIANA DE SOUZA CASTRO
  • OSMINDO RODRIGUES PIRES JUNIOR
  • Data: 23/10/2023

  • Mostrar Resumo
  • Os peptídeos antimicrobianos são moléculas produzidas naturalmente por uma variedade de organismos, incluindo anfíbios como sapos e rãs que os secretam na pele como uma forma de defesa contra patógenos. Esses peptídeos atuam contra uma ampla gama de bactérias, fungos e vírus e possuem potencial terapêutico significativo devido à sua capacidade de matar microrganismos sem causar danos às células humanas. A aplicação desses peptídeos é promissora em diversas áreas, como no desenvolvimento de novos antibióticos e no tratamento de infecções. Além disso, eles estão sendo estudados como uma alternativa aos antibióticos tradicionais que são cada vez mais ineficazes devido à seleção de genes de resistência microbiana. No entanto, apesar do potencial promissor desses peptídeos, ainda há muita pesquisa a ser feita para entender melhor sua eficácia em diferentes contextos e a viabilidade de sua aplicação em grande escala. Além da atividade antimicrobiana, os peptídeos presentes na secreção cutânea de anuros também podem exibir atividade imunomodulatória, o que significa que eles podem afetar a função do sistema imunológico. Esses peptídeos podem agir como agentes pró-inflamatórios ou anti-inflamatórios, regulando a resposta imunológica do organismo. O presente projeto teve como objetivo avaliar o efeito antibacteriano e sinérgico dos peptídeos antimicrobianos pentadactilina e falaxina em bactéria multirresistente Klebsiella pneumoniae carbapenemase (KPC). Adicionalmente, foi avaliada a resposta de neutrófilos humanos expostos a essas moléculas. A purificação por RPHPLC e a análise por espectrometria de massas revelou um alto grau de homogeneidade desses peptídeos para a realização dos ensaios propostos. Ambos os peptídeos apresentaram atividade antibacteriana contra bactéria KPC (Concentração Inibitória Mínima, CIM = 128 μM para os dois peptídeos), e os danos promovidos foram avaliados por microscopia eletrônica de varredura (MEV), em que se evidenciou deformações na membrana dessa bactéria, o que possivelmente leva à desestruturação da parede e lise do microrganismo. Os testes de combinação de drogas entre os peptídeos e o antibiótico polimixina B indicaram que ambos apresentam efeitos sinérgicos, diminuindo a CIM quando testados contra a bactéria KPC. Na avaliação de seus efeitos imunomodulatórios, ambos os peptídeos não apresentaram resultados significativos quando modularam a resposta fagocitária dos neutrófilos. A falaxina promoveu uma diminuição na produção de Espécies Reativas de Oxigênio (EROs). Ambos os peptídeos não exibiram potencial quimiotático. Os efeitos sinérgicos e imunomodulatórios sobre neutrófilos dos peptídeos pentadactilina e falaxina demonstram outras possibilidades de aplicação terapêutica para esses peptídeos.


  • Mostrar Abstract
  •  

    Antimicrobial peptides are molecules produced naturally by a variety of organisms, including amphibians such as toads and frogs that secrete them into their skin as a form of defense against pathogens. These peptides act against a wide range of bacteria, fungi and viruses and have significant therapeutic potential due to their ability to kill microorganisms without causing harm to human cells. The application of these peptides is promising in several areas, such as the development of new antibiotics and the treatment of infections. Furthermore, they are being studied as an alternative to traditional antibiotics that are increasingly ineffective due to the selection of microbial resistance genes. However, despite the promising potential of these peptides, there is still much research to be done to better understand their effectiveness in different contexts and the feasibility of their large-scale application. In addition to antimicrobial activity, peptides present in anuran skin secretions can also exhibit immunomodulatory activity, which means they can affect the function of the immune system. These peptides can act as proinflammatory or antiinflammatory agents, regulating the body's immune response. The present project aimed to evaluate the antibacterial and synergistic effect of the antimicrobial peptides pentadactylin and fallaxin on multidrug-resistant bacteria Klebsiella pneumoniae carbapenemase (KPC). Additionally, the response of human neutrophils exposed to these molecules was evaluated. Purification by RP-HPLC and mass spectrometry analysis revealed a high degree of homogeneity of these peptides for carrying out the proposed assays. Both peptides showed antibacterial activity against KPC bacteria (Minimum Inhibitory Concentration, MIC = 128 μM for both peptides), and the damage caused was evaluated by scanning electron microscopy (SEM), which showed deformations in the membrane of this bacterium, which which possibly leads to the destruction of the wall and lysis of the microorganism. Drug combination tests between the peptides and the antibiotic polymyxin B indicated that both have synergistic effects, reducing the MIC when tested against KPC bacteria. When evaluating their immunomodulatory effects, both peptides did not show significant results when modulating the phagocytic response of neutrophils. Fallaxin promoted a decrease in the production of Reactive Oxygen Species (ROS). Both peptides did not exhibit chemotactic potential. The synergistic and immunomodulatory effects of the peptides pentadactylin and fallaxin on neutrophils demonstrate other possibilities of therapeutic application for these peptides.

6
  • LUANY ALVES GALVÃO MARTINHÃO
  • "Uso do extrato de levedura (YE) como alternativa ao soro fetal bovino (SFB) no cultivo in vitro de embriões bovinos".

  • Orientador : JOÃO HENRIQUE MOREIRA VIANA
  • MEMBROS DA BANCA :
  • JOAO GABRIEL VIANA DE GRAZIA
  • JOÃO HENRIQUE MOREIRA VIANA
  • LUIZ GUSTAVO BRUNO SIQUEIRA
  • MARGOT ALVES NUNES DODE
  • Data: 06/11/2023

  • Mostrar Resumo
  • A bovinocultura é uma das atividades de maior destaque no agronegócio do Brasil. Em 2022, o país continuou liderando como o maior exportador de carne bovina do mundo. Essa realidade só foi alcançada pela multiplicação do número de descentes de animais de maior valor genético, proporcionado pelo uso intensivo das biotecnologias na área da reprodução animal. Dentre as biotecnologias, o Brasil tornou-se uma referência na produção in vitro de embriões bovinos (PIVE). Ainda que a PIVE na espécie bovina seja uma técnica estabelecida e já utilizada comercialmente, diversos esforços são realizados para melhorar seus indicadores quantitativos e qualitativos. Um exemplo é o aperfeiçoamento dos meios de cultivo, seja pelo ajuste das propriedades físico-químicas, pela adição de agentes com potencial antioxidantes ou pela suplementação com nutrientes ou fontes de fatores embriotróficos como, por exemplo, o soro fetal bovino (SFB). A suplementação com SFB possui efeitos benéficos no desenvolvimento embrionário in vitro, porém sua composição é indefinida e pode variar entre os lotes. O uso do SFB tem sido associado a alterações metabólicas nos embriões, com potencial impacto nos resultados da criopreservação. Além disso, como é um produto de origem animal, há um risco intrínseco de veiculação de patógenos, e existem questões éticas relacionadas ao seu processo de fabricação. Desse modo, torna-se necessário buscar alternativas ao uso do SFB nos sistemas de cultivo. O presente trabalho traz uma revisão sobre a suplementação proteica durante o cultivo in vitro de embriões, e apresenta os resultados experimentais do uso do Extrato de Levedura (Yeast Extract – YE), como uma nova fonte proteica alternativa para substituir o SFB durante o CIV. O YE é conhecido por melhorar sistemas de cultivos celulares de outros de mamíferos, pois em sua composição há presença de componentes importantes para o metabolismo celular, além de apresentar maior padronização dos lotes e risco sanitário desprezível, quando comparado ao SFB. De maneira geral, os resultados obtidos demonstram que, o uso do YE 1% (0,1mg/mL), como suplemento, não compromete o desenvolvimento embrionário ou as taxas de gestação pós-transferência à fresco, associado a BSA (3mg/mL) em sistemas sequenciais e com baixa tensão de oxigênio (5,5%), porém o YE causa maior acúmulo de lipídios no citoplasma.


  • Mostrar Abstract
  • Cattle farming is one of the most important activities in the Brazilian agricultural sector. In 2022, the country continued to lead as the largest beef exporter in the world. This reality was only achieved by multiplication of the number of offspring from animals of greater genetic value, subsequent to the intensive use of reproductive biotechnologies. Brazil has become a reference in the development and commercial use of in vitro embryo production (IVEP) in cattle. Nevertheless, a number of quantitative and qualitative endpoints still need to be optimized. One example is the improvement of culture media, either by adjusting the physicalchemical properties, by adding agents with antioxidant potential, or by the supplementation with nutrients or sources of embryotrophic factors such as the fetal bovine serum (FBS). Supplementation with FBS has beneficial effects on in vitro embryonic development. However, its composition is undefined and may vary between batches. The use of FBS has been associated with metabolic alterations in embryos, with a potential negative impact on cryopreservation results. In addition, as it is a product of animal origin, there is an intrinsic risk of transmitting pathogens, as well as ethical issues related to its manufacturing process. Thus, it is necessary to search for alternatives to the use of SFB in embryo culture systems. This dissertation presents a review of protein supplementation during in vitro embryo culture, and the results of experiments aiming at use Yeast Extract (YE) as an alternative protein source to replace FBS during IVC. YE is known for improving cell culture systems of other mammals, as its composition contains important components for cell metabolism, in addition to presenting greater standardization among batches and negligible health risk, when compared to FBS. In general, the results obtained demonstrate the use of YE 1% (0.1mg/mL), as a supplement, doesn't compromise embryonic development or fresh post-transfer pregnancy rates, associated with BSA (3mg/mL) in sequential systems with low oxygen tension (5.5%), but YE causes greater accumulation of lipids in the cytoplasm.

Teses
1
  • Luciana Maia Escher dos Santos Sousa
  • Ancestralidade genética em populações miscigenadas: desafios, aplicações e um olhar sobre a história da formação do Distrito Federal

  • Orientador : SILVIENE FABIANA DE OLIVEIRA
  • MEMBROS DA BANCA :
  • SILVIENE FABIANA DE OLIVEIRA
  • RENATO CAPARROZ
  • Celso Teixeira Mendes Junior
  • Claudio Carlos da Silva
  • Renan Barbosa Lemes
  • Data: 28/04/2023

  • Mostrar Resumo
  • O Brasil é o país mais populoso da América Latina e o sétimo no ranking mundial sendo sua população resultante de um longo processo de miscigenação com contribuições dos povos originários nativos americanos e de povos europeus, africanos, asiáticos e do Oriente Médio. O perfil de miscigenação da população brasileira está sendo construído ao longo dos últimos cinco séculos, a partir de uma complexa combinação de grupos parentais raramente vista em outras partes do mundo. Um importante papel para auxiliar a desvendar a história das populações e seu processo de formação tem sido exercido pelos estudos genéticos. Ao longo das últimas décadas, a genética de populações tem passado por grandes transformações tecnológicas e metodológicas, as quais têm possibilitado o acesso preciso e em larga escala de variáveis genéticas cada vez mais informativas. No primeiro capítulo desta tese nosso grupo trabalhou na comparação da inferência de ancestralidade genética a partir de diferentes conjuntos de marcadores genéticos: Marcadores Informativos de Ancestralidade (AIMs), array de alta densidade de SNPs (high density SNPs - HDSNPs) e Sequenciamento do Genoma Completo (Whole Genome Sequencing - WGS). Também testamos, diferentes modelos de miscigenação: o tri-híbrido (africano, europeu e nativo americano) e modelo de mistura tetra-híbrida (africano, europeu, nativo americano e leste asiático). Para tanto, analisamos 1.171 amostras miscigenadas do Brasil e 504 amostras miscigenadas provenientes de populações da América do Projeto 1000 Genomas, ambos genotipados por WGS, com as quais comparamos: (i) 5 painéis AIMS (34AISNP+PIMA; 55AISNP ; 128AISNP; 170AISNP; 446AISNP), (ii); um array de alta densidade de SNPs (Axiom Human Origins - Thermo Fisher Scientific) e (iii) dados de sequenciamento de genoma completo (WGS), os quais foram selecionados por suportarem os modelos tri e tetra-híbridos de miscigenação. Mostramos que tanto a escolha do conjunto de marcadores como do modelo de miscigenação interferem nas inferências de ancestralidade em populações miscigenadas. A menor correlação entre os conjuntos de marcadores e modelos testados foi do componente ancestral Nativo Americano inferido. As melhores performances, em especial na capacidade de distinção entre os componentes Nativo Americano e Leste Asiático foram dos dados de HDSNPs e WGS. Por fim, concluímos e recomendamos que a escolha do conjunto de marcadores e do modelo de miscigenação dependerá da história de cada população miscigenada e do propósito do estudo. No segundo capítulo da tese, caracterizamos o perfil de ancestralidade genética de uma amostra populacional miscigenada brasileira do Distrito Federal. Com base nas informações geradas no capítulo 1, escolhemos realizar a genotipagem dessa amostra com HDSNPs (Axiom Human Origins - Thermo Fisher Scientific) e inferir a ancestralidade genética a partir de um modelo de miscigenação tetrahíbrido. O Distrito Federal (DF) é uma região situada no Centro Oeste do Brasil, receptora de um fluxo rápido, amplo e diversificado de indivíduos de toda parte do território nacional a partir da década de 60, quando da construção da capital federal. Para ajudar a reconstruir a história dessa população, realizamos análises do perfil de ancestralidade genética e coletamos informações demográficas numa amostra de 104 indivíduos, nascidos no DF na década de 80. Nosso estudo revelou: (i) com base na inferência de ancestralidade genética dos cromossomos autossômicos as proporções médias observadas foram de 69,95% (±18%) de ancestralidade europeia, 19,8%(±14,4%) africana, 8,57% (±7,2%) nativo americana e 1,68%(±8,6%) leste asiática; essas proporções não apresentam diferenças significativas em relação a média da população brasileira. (ii) As análises dos cromossomos sexuais (X, Y) e do DNA mitocondrial mostraram assinaturas do fenômeno demográfico de acasalamento direcional, com predomínio da contribuição de homens de ascendência europeia e de mulheres com ascendência africana e nativa americana. (iii) As análises demográficas indicam que os ancestrais dos participantes do estudo migraram principalmente das regiões Sudeste (43,64%) e Nordeste (38,22%), seguida pelas regiões Centro-Oeste (9,39%), Norte (5,52%) e Sul (1,65%); sendo 51,2% dos matrimônios ocorrendo entre indivíduos da mesma região geográfica. Nosso estudo mostra que o perfil de ancestralidade genética observado no DF é uma síntese das contribuições migratórias internas recentes do Brasil e de processos históricos anteriores a essa migração que deixaram fortes assinaturas genéticas no DNA e foram herdadas pela população do DF.


  • Mostrar Abstract
  • Brazil is the most populous country in Latin America and the seventh in the world, its population resulting from a long admixture process with contributions from Native American, European, African, Asian and Middle Eastern peoples. The Brazilian admixed profile has been built over the last five centuries, based on a complex combination of parental groups rarely seen in other parts of the world. An important role to unravel the history of populations and their origin process has been played by populational genetic studies. Over the last few decades, population genetics has undergone major technological and methodological changes, which have enabled precise and large-scale access to increasingly informative genetic variants. In the first chapter of this thesis, we compared the genetic ancestry inference from different sets of genetic markers: Ancestry Informative Markers (AIMs), high-density SNPs array (HDSNPs) and Whole Genome Sequencing (Whole Genome Sequencing - WGS). We also tested different admixture models: the tri-hybrid (African, European and Native American) and tetra-hybrid (African, European, Native American and East Asian). To do so, we analyzed 1,171 unrelated samples from Brazil and 504 unrelated samples from admixed American populations from the 1000 Genomes Project, both genotyped by WGS, with which we compared: (i) 5 AIMs panels (34AISNP+PIMA; 55AISNP; 128AISNP; 170AISNP; 446AISNP), (ii); a high-density array of SNPs (Axiom Human Origins - Thermo Fisher Scientific) and (iii) Whole Genome Sequencing (WGS) data, which were selected for supporting tri- and tetra-hybrid admixture models. We show that both the choice of marker set and the admixture model interfere with ancestry inferences in admixed populations. The lowest correlation between the marker sets and models tested was for the inferred Native American ancestral component. The best performances, especially in the ability to distinguish between the Native American and East Asian components, were from the HDSNPs and WGS data. Finally, we conclude and recommend that the choice of the set of markers and the admixture model will depend on the history of each admixed population and the purpose of the study. In the second chapter of the thesis, we characterize the genetic ancestry profile of an admixed Brazilian population sample from the Federal District. Based on the information generated in Chapter 1, we chose to genotype this sample with HDSNPs (Axiom Human Origins - Thermo Fisher Scientific) and infer the genetic ancestry from a tetra-hybrid admixture model. The Federal District (DF) is a region located in the Midwest of Brazil, receiving a fast, wide and diversified flow of individuals from all parts of the national territory from the 60's, when the federal capital was built. To reconstruct the history of this population, we performed analyzes of the genetic ancestry profile and collected demographic information on a sample of 104 individuals, born in the DF in the 1980s. Our study revealed: (i) based on the inference of genetic ancestry from the chromosomes autosomal the average proportions observed were 69.95% (±18%) of European ancestry, 19.8% (±14.4%) African, 8.57% (±7.2%) Native American and 1.68 %(±8.6%) East Asia; these proportions is not significant different from the average of the Brazilian population. (ii) Analysis of sex chromosomes (X, Y) and mitochondrial DNA showed signatures of the demographic phenomenon of directional mating, with a predominance of contributions from men of European descent and women of African and Native American descendants. (iii) Demographic analyzes indicate that the study participants' ancestors migrated mainly from the Southeast (43.64%) and Northeast (38.22%) regions, followed by the Midwest (9.39%), North (5 .52%) and South (1.65%); with 51.2% of marriages occurring between individuals from the same geographic region. Our study shows that the genetic ancestry profile observed in the DF is a synthesis of recent internal migration contributions from Brazil and historical processes prior to this migration that left strong genetic signatures in the DNA and was inherited by the DF population.

2
  • Camila Magalhães Cardador
  • DOXORUBICIN-INDUCED IMMUNOGENIC CELL DEATH IS ABLE TO IMPAIR TUMOR PROGRESSION AND DISTANT METASTASIS IN A HIGHLY AGGRESSIVE BREAST CANCER TUMOR MODEL

  • Orientador : JOAO PAULO FIGUEIRO LONGO
  • MEMBROS DA BANCA :
  • JOAO PAULO FIGUEIRO LONGO
  • KELLY GRACE MAGALHAES
  • LUANA CRISTINA CAMARGO
  • MARTHA DE SOUZA TEIXEIRA ROCHA
  • MOSAR CORREA RODRIGUES
  • Data: 20/06/2023

  • Mostrar Resumo
  • O câncer é uma doença individual, e sua formação e desenvolvimento são específicos para cada hospedeiro. Os tratamentos convencionais são ineficazes em casos complexos como metástases e apresentam efeitos adversos graves. Novas estratégias são necessárias para abordagem do problema, e o uso da Morte Celular Imunogênica como um iniciador de resposta do sistema imunológico através da exposição de padrões moleculares associados a danos (DAMPs) por células cancerígenas é apresentado como uma abordagem de vacinação terapêutica personalizada neste trabalho. Para isso, células de adenocarcinoma mamário murino foram expostas à doxorrubicina com o intuito de induzir a liberação de marcadores associados à morte celular imunogênica, como ATP e calreticulina, e enxertadas subcutaneamente em camundongos BALB/c. Como controle do protocolo, as células foram também expostas à morte por necrose. Este protocolo, aqui chamado de “vacinação”, foi realizado três vezes, com um intervalo de sete dias entre cada repetição. Após o último transplante das células em estágio de morte imunogênica, o protocolo de vacinação foi desafiado com o enxerto subcutâneo das mesmas células cancerosas, sem exposição à doxorrubicina, no flanco oposto ao da vacinação. O estágio de “desafio” consiste em avaliar se há, ou não, resposta imunológica específica dos camundongos às células cancerosas. O acompanhamento clínico dos camundongos foi realizado por 6 semanas, nas quais os camundongos foram tomografados para avaliação do surgimento de metástases pulmonares e tiveram a aparição e volume tumoral monitorados. A indução de morte celular imunogênica iniciada por doxorrubicina nas células de adenocarcinoma mamário murino foi avaliada por citometria de fluxo e análise de imagem. Os resultados mostraram que os camundongos vacinados com células em estágio de morte celular imunogênica após exposição à doxorrubicina não apresentaram tumor primário durante as 6 semanas de avaliação, bem como não houve indicativos de desenvolvimento de lesões metastáticas em sítios secundários.


  • Mostrar Abstract
  • Cancer is an individual disease, and its formation and development are specific to each host. Conventional treatments are ineffective in complex cases such as metastases and have serious adverse effects. New strategies are needed to approach the problem, and the use of Immunogenic Cell Death as an initiator of the immune system response through the exposure of damage-associated molecular patterns (DAMPs) by cancer cells is presented as a personalized therapeutic vaccination approach in this work. To this purpose, murine mammary adenocarcinoma cells were exposed to doxorubicin in order to induce the release of markers associated with immunogenic cell death, such as ATP and calreticulin, and grafted subcutaneously in BALB/c mice. As a protocol control, cells were also exposed to death by necrosis. This protocol, here called “vaccination”, was performed three times, with an interval of seven days between each repetition. After the last transplantation of cells in the stage of immunogenic death, the vaccination protocol was challenged with subcutaneous grafting of the same unexposed cancer cells, without exposure to doxorubicin, on the flank opposite that of vaccination. The “challenge” stage assesses whether or not mice have a specific immune response to the cancer cells. The clinical follow-up of the mice was carried out for 6 weeks, during which the mice were scanned to assess the appearance of pulmonary metastases and had their tumor appearance and volume monitored. Flow cytometry and image analysis evaluated the induction of doxorubicin-initiated immunogenic cell death in murine mammary adenocarcinoma cells. The results showed that mice vaccinated with cells in the immunogenic cell death stage after exposure to doxorubicin did not present a primary tumor during the 6 weeks of evaluation, as well as there were no indications of the development of metastatic lesions in secondary sites.

3
  • Ingrid de Souza Freire
  • " Impactos ecotoxicológicos de microplásticos de polietileno no peixe Danio rerio e no caramujo Biomphalaria glabrata".

  • Orientador : CESAR KOPPE GRISOLIA
  • MEMBROS DA BANCA :
  • CESAR KOPPE GRISOLIA
  • MARCIO JOSE POCAS FONSECA
  • MARIANA DE SOUZA CASTRO
  • Thiago Lopes Rocha
  • Lenita de Freitas Tallarico
  • Data: 30/06/2023

  • Mostrar Resumo
  • Microplásticos são partículas com tamanho entre 5 - 1 mm, são considerados poluentes emergentes e presentes no mundo todo. Em virtude do seu tamanho eles apresentam o potencial de atingir vários níveis da cadeia alimentar. Peixes e macroinvertebrados bentônicos estão suscetíveis a essa exposição e poucos dados na literatura relevam os efeitos adversos de microplásticos em organismos pequenos e de água doce. O objetivo deste trabalho foi avaliar o potencial ecotoxicológico de microplásticos (MPs) de polietileno em duas espécies aquáticas, o peixe Danio rerio, ou zebrafish, e o caramujo bentônico de água doce Biomphalaria glabrata, além da caracterizar esses microplásticos (MPs). Em zebrafish a toxicidade foi avaliada por meio do teste de embriotoxicidade, pelo teste de depuração dessas micropartículas em juvenis e em adultos, por meio de testes de genotoxicidade, citotoxicidade, histologia e marcadores bioquímicos em exposições de 96 horas e 28 dias, com um período de recuperação de 14 dias. Em caramujos adultos de B. glabrata foi investigado a alteração de marcadores bioquímicos em uma exposição aguda de 96 horas e em um teste de recuperação de 49 dias, recuperação dependente. Além disso, verificou-se o potencial de depuração de MPs em juvenis e adultos de Biomphalaria glabrata. A caracterização dos microplásticos de polietileno por microscopia eletrônica de varredura e análise em programa FijiJ, que mostraram partículas esféricas, com uma média de 58 µm de diâmetro (± 4,52 dp). Em peixes, não foram observadas alterações significativas em embriões pelo teste de embriotoxicidade, e o teste de depuração em juvenis mostrou que no 12 º dia de recuperação eles eliminaram todas as MPs. Já nos adultos, na exposição aguda, houve uma inibição da amônia tóxica em todos os grupos expostos quando comparados ao controle água, a diminuição foi nove vezes menor no grupo de 100 mg.L-1 . Isso foi confirmado na exposição crônica, com valores de p significativos (< 0,05), tanto para microplástico quanto para o dispersante Tween 80 %. No teste de recuperação, a inibição de amônia tóxica deixa de ser significativa nos aquários que continham Tween 80 % após 8 dias. Nos aquários com microplásticos somente após 14 dias percebe-se que essa diminuição deixa de ser estatisticamente significativa. As análises histológicas mostraram que os MPs se acumulam no lúmen intestinal, mas não em outros órgãos. Não foi observado genotoxicidade nos testes do cometa, nos testes de micronúcleos e de citotoxicidade, por anomalias nucleares na exposição aguda. Houve diminuição significativa dos níveis de AChE tanto nos testes agudo e crônico em amostras da cabeça, e no teste de recuperação a diminuição ocorreu nas amostras da cauda (p < 0,05). A GST teve aumento significativo nos testes agudo, crônico e de recuperação (p < 0,05), e o LDH teve resultado estatisticamente significativo na exposição crônica (p < 0,05). Em adultos de B. glabrata, não foram observados valores estatisticamente significativos na concentração total de proteínas, na concentração de glicose, na atividade de LDH e AChE (p > 0,05). Entretanto, houve uma diminuição significativa (p < 0,05) na atividade de GST. No teste de depuração, os juvenis levaram 20 dias para eliminar totalmente os MPs e os adultos não conseguiram eliminar todas as partículas no total de 49 dias de recuperação em água mole sintética. Ademais, as análises em juvenis e adultos mostraram que as MPs também se concentram principalmente no estômago e no intestino desses caramujos. Verifica-se que esses microplásticos de polietileno esféricos com 58 µm de diâmetro, causaram estresse oxidativo em zebrafish, mas não o suficiente para causar genotoxicidade. Além disso, a capacidade de depuração em juvenis de zebrafish é significantemente rápida, em torno de 15 dias. Os MPs se acumulam no lúmen do intestino, e apesar disso, 14 dias de recuperação não foram o suficiente para que eles se recuperassem totalmente do estresse oxidativo. Em caramujos, esses MPs também causaram estresse oxidativo, porém, apenas em um marcador, o que revela que os caramujos B. glabrata são mais resistentes do que zebrafish a esses microplásticos de polietileno. Com relação a depuração, os juvenis se mostraram mais eficiente na eliminação de MPs do que caramujos adultos. Em conclusão, os efeitos toxicológicos de microplásticos de polietileno dependem da espécie ao qual estão sendo expostos, da concentração e do tempo de exposição.


  • Mostrar Abstract
  • Microplastics (MPs) are classified as particles with size between 5 - 1 mm. They are considered as emerging pollutants, which have been found in worldwide. Due to their small size, they have the potential to reach different levels of the food chain. Fish and benthic macroinvertebrates are susceptible to exposures to MPs, and there is a lack of data in the literature revealing the adverse effects of such microparticle on freshwater organisms. The purposes of this work were to carry out bioassays to investigate the toxicity of polyethylene microplastics using different endpoints in two aquatic species as Danio rerio (zebrafish), and in the freshwater benthic snail Biomphalaria glabrata. In zebrafish, the toxicity was evaluated through fish embryotoxicity test, following by the clearance test in juveniles and in adults, using the endpoints of genotoxicity, cytotoxicity, histology and biochemical marker after exposures of 96 hours (acute test), and 28 days (chronic test), following a 14-day recovery – clearance test. In adults of B. glabrata, the biochemical markers were investigated in a 96-hour acute exposure test, and also after 49-day recovery test. In addition, the capability for clearance of such MPs in juveniles and adults of B. glabrata were verified. The characterization of polyethylene microplastics was performed by scanning eléctron microscopy, analyzed with Fiji J software showing spherical particles, with an average of 58 µm in diameter (± 4.52 DP). In zebrafish, no significant embryotoxicity were observed, and the clearance test in juveniles showed that after 12 days in clean water the MPs were completely eliminated. In zebrafish adults, the acute exposures showed significative inhibition of toxic ammonia in all exposed groups when compared to the controls, and this inhibition was nine times down in the 100 mg. L-1 group. This was confirmed in the chronic exposure test, with significant p-values (<0.05) for microplastic exposures as well as exposures to Tween 80% dispersant. In the recovery test, the inhibition of toxic ammonia was not significative for Tween after 8 days. For microplastics, after 14 days, there decrease was no longer statistically significant. The histological analyzes showed that MPs accumulate in the intestinal lumen, but not in other organs. The acute exposure test showed no genotoxicity through comet tests and micronucleus tests, and no cytotoxicity for nuclear abnormalities. The AChE levels were significantly decreased in the acute and chronic tests in the samples from head. In the recovery test, this decrease occurred only in the tail samples (p < 0.05). The GST was significantly increased in acute, chronic and recovery tests (p < 0.05). The LDH levels were statistically significant in the chronic exposure (p < 0.05). In adult snails of B. glabrata, no statistically significant values were observed for total protein concentration, glucose concentration, LDH and AChE activity (p > 0.05); however, the GST the activities were decreased (p < 0,05). In the recovery test, the juvenile snails the total clearance occurred about 20 days, while for the adults was about 49 days. Furthermore, analyzes in juveniles and adults showed that MPs are concentrated mainly in the stomach and intestine of these snails. It can be seen that these spherical polyethylene microplastics, measuring 58 µm in diameter in average, caused oxidative stress in zebrafish, but not enough to cause genotoxicity. In addition, the clearance in zebrafish juveniles is significantly faster, around 15 days. The MPs were slowly eliminated from the lumen of the intestine, and 14 days of recovery period were not enough to recover from the oxidative stress cause before. In snails, these MPs caused oxidative stress as well, but it was observed in only one marker, revealing that B. glabrata are more resistant than zebrafish to these polyethylene microplastics. Regarding the depuration test, the juvenile snails are more efficient in eliminating MPs than adults. In conclusion, the toxicological effects of polyethylene microplastics depend on the species to which they are exposed, the exposureconcentrations, and the exposure-time.

4
  • Amanda Alencar Cabral Morais
  • Terapia multimodal para tratamento de câncer colorretal resistente à quimioterapia

  • Orientador : RICARDO BENTES DE AZEVEDO
  • MEMBROS DA BANCA :
  • ARNOBIO ANTONIO DA SILVA JUNIOR
  • DANIELA MARA DE OLIVEIRA
  • MONICA PEREIRA GARCIA
  • MOSAR CORREA RODRIGUES
  • RICARDO BENTES DE AZEVEDO
  • Data: 31/07/2023

  • Mostrar Resumo
  • A aquisição de resistência a quimioterapia é um grande desafio na terapia an7câncer. Apesar de ser u7lizada como o tratamento de primeira linha para tumores colorretais (CRC) avançados ou metastá7cos, o desenvolvimento de resistência à oxalipla7na (L-OHP) é um problema que acomete 40% dos pacientes tratados e está relacionado à baixa taxa de sobrevivência desses pacientes. Obje0vo: Analisar o efeito combinado de curcumina livre (CURC) ou nanoparQculas lipídicas sólidas com curcumina (NLSC), terapia fotodinâmica (TFD) mediada por alumínio-cloro Yalocianina (NE-AlClFt) em nanoemulsão, para melhorar a resposta da L-OHP no tratamento de uma linhagem de CRC L-OHP-resistente, visando reverter o perfil de resistência e sensibilizar as células à quimioterapia com L-OHP. Métodos: O ensaio de citotoxicidade (MTT) foi u7lizado para determinar a concentração de L-OHP necessária para matar 50% (IC50) das células da linhagem de carcinoma colorretal humano (HCT116-S). A linhagem HCT116 resistente à L-OHP (HCT116-R) foi estabelecida por meio da exposição a concentrações crescentes de L-OHP até o valor de 10x o IC50. Ao final, as linhagens HCT116-S e HCT116-R foram caracterizadas quanto ao tempo de duplicação, taxa de crescimento, capacidade de formar esferas tumorais e análise do ciclo/morte por citometria de fluxo. Foi determinado o IC50 para os tratamentos CURC, NLSC e TFD, seguido da análise de sinergismo de cada combinação terapêu7ca. As combinações terapêu7cas foram avaliadas quanto ao efeito na viabilidade celular, capacidade clonogênica, capacidade migratória, perfil de morte celular e expressão gênica. Resultados: A linhagem HCT116- R foi estabelecida em 11 meses, apresentando IC50 para L-OHP significa7vamente diferente da linhagem original (2,7±0,3 µM e 26,6±1,5 µM para HCT116-S e HCT116-R, respec7vamente). Quando comparada com HCT116-S, as células HCT116-R apresentaram mudanças significa7vas na taxa de crescimento e na capacidade de formar esferas tumorais. O valor de IC50 ob7do para cada tratamento foi: HCT116-S= (CURC): 7,2±0,6 µM; (NLSC): 7,1±1,3 µM; e (TFD): 4,4±0,2 µM; para a linhagem HCT116-R= (CURC): 5,1±0,8 µM; (NLSC): 9,4±0,6 µM; e (TFD): 5,3±0,1 µM. O ensaio de efeito sinérgico mostrou uma dose-dependência em ambas as linhagens, sendo escolhida a combinação terapêu7ca: pré-tratamento com TFD [IC50], seguido da exposição à L-OHP [½ do IC50] e CURC [IC50]. O tratamento combinatório foi eficaz quanto à redução da viabilidade celular, capacidade clonogênica e capacidade migratória. HCT116-R tratadas com L-OHP+CURC e TFD+L-OHP+CURC apresentaram maior tendência de morte por necrose. As células HCT116-R 7veram redução na expressão de genes envolvidos em vias relacionadas a transcrição e regulação da expressão gênica, no entanto, quando tratadas, houve um aumento da expressão dos genes envolvidos nessas vias. Um total de 20 genes candidatos foram selecionados para validação futura por RT-qPCR, os quais se relacionam principalmente com a a7vidade de p53, resposta a dano celular, e desenvolvimento tumoral. Conclusões: As caracterís7cas observadas para a linhagem HCT116-R são consistentes com o perfil de resistência. O tratamento mul7modal TFD+LOHP+CURC é eficaz para melhorar o efeito da L-OHP, mesmo u7lizando uma concentração baixa do quimioterápico, possibilitando manter a eficácia terapêu7ca, sem necessidade de aumentar a concentração de L-OHP, trazendo perspec7va futura de redução de efeito tóxicos comumente associados a u7lização da L-OHP


  • Mostrar Abstract
  • A aquisição de resistência a quimioterapia é um grande desafio na terapia an7câncer. Apesar de ser u7lizada como o tratamento de primeira linha para tumores colorretais (CRC) avançados ou metastá7cos, o desenvolvimento de resistência à oxalipla7na (L-OHP) é um problema que acomete 40% dos pacientes tratados e está relacionado à baixa taxa de sobrevivência desses pacientes. Obje0vo: Analisar o efeito combinado de curcumina livre (CURC) ou nanoparQculas lipídicas sólidas com curcumina (NLSC), terapia fotodinâmica (TFD) mediada por alumínio-cloro Yalocianina (NE-AlClFt) em nanoemulsão, para melhorar a resposta da L-OHP no tratamento de uma linhagem de CRC L-OHP-resistente, visando reverter o perfil de resistência e sensibilizar as células à quimioterapia com L-OHP. Métodos: O ensaio de citotoxicidade (MTT) foi u7lizado para determinar a concentração de L-OHP necessária para matar 50% (IC50) das células da linhagem de carcinoma colorretal humano (HCT116-S). A linhagem HCT116 resistente à L-OHP (HCT116-R) foi estabelecida por meio da exposição a concentrações crescentes de L-OHP até o valor de 10x o IC50. Ao final, as linhagens HCT116-S e HCT116-R foram caracterizadas quanto ao tempo de duplicação, taxa de crescimento, capacidade de formar esferas tumorais e análise do ciclo/morte por citometria de fluxo. Foi determinado o IC50 para os tratamentos CURC, NLSC e TFD, seguido da análise de sinergismo de cada combinação terapêu7ca. As combinações terapêu7cas foram avaliadas quanto ao efeito na viabilidade celular, capacidade clonogênica, capacidade migratória, perfil de morte celular e expressão gênica. Resultados: A linhagem HCT116- R foi estabelecida em 11 meses, apresentando IC50 para L-OHP significa7vamente diferente da linhagem original (2,7±0,3 µM e 26,6±1,5 µM para HCT116-S e HCT116-R, respec7vamente). Quando comparada com HCT116-S, as células HCT116-R apresentaram mudanças significa7vas na taxa de crescimento e na capacidade de formar esferas tumorais. O valor de IC50 ob7do para cada tratamento foi: HCT116-S= (CURC): 7,2±0,6 µM; (NLSC): 7,1±1,3 µM; e (TFD): 4,4±0,2 µM; para a linhagem HCT116-R= (CURC): 5,1±0,8 µM; (NLSC): 9,4±0,6 µM; e (TFD): 5,3±0,1 µM. O ensaio de efeito sinérgico mostrou uma dose-dependência em ambas as linhagens, sendo escolhida a combinação terapêu7ca: pré-tratamento com TFD [IC50], seguido da exposição à L-OHP [½ do IC50] e CURC [IC50]. O tratamento combinatório foi eficaz quanto à redução da viabilidade celular, capacidade clonogênica e capacidade migratória. HCT116-R tratadas com L-OHP+CURC e TFD+L-OHP+CURC apresentaram maior tendência de morte por necrose. As células HCT116-R 7veram redução na expressão de genes envolvidos em vias relacionadas a transcrição e regulação da expressão gênica, no entanto, quando tratadas, houve um aumento da expressão dos genes envolvidos nessas vias. Um total de 20 genes candidatos foram selecionados para validação futura por RT-qPCR, os quais se relacionam principalmente com a a7vidade de p53, resposta a dano celular, e desenvolvimento tumoral. Conclusões: As caracterís7cas observadas para a linhagem HCT116-R são consistentes com o perfil de resistência. O tratamento mul7modal TFD+LOHP+CURC é eficaz para melhorar o efeito da L-OHP, mesmo u7lizando uma concentração baixa do quimioterápico, possibilitando manter a eficácia terapêu7ca, sem necessidade de aumentar a concentração de L-OHP, trazendo perspec7va futura de redução de efeito tóxicos comumente associados a u7lização da L-OHP.

5
  • Cecibel María León Félix
  • Obtenção de matriz extracelular descelularizada de córtex ovariano bovino e sua caracterização ".

  • Orientador : CAROLINA MADEIRA LUCCI
  • MEMBROS DA BANCA :
  • CAROLINA MADEIRA LUCCI
  • JULIANA LOTT DE CARVALHO
  • ELLEN CRISTINA RIVAS LEONEL
  • MARGOT ALVES NUNES DODE
  • MAURÍCIO MACHAIM FRANCO
  • Data: 31/08/2023

  • Mostrar Resumo
  • A matriz extracelular descelularizada (MEC) de vários tecidos (coração, pulmão, rim, útero e testículo) está permitindo a regeneração e a recuperação das células nativas e das funções do tecido. Uma alternativa para manter a fertilidade em mulheres diagnosticadas com câncer, que se tornariam inférteis devido à quimioterapia e/ou radioterapia, é o desenvolvimento de um ovário artificial transplantável. A MEC descelularizada do tecido ovariano foi obtida usando dodecil sulfato de sódio (SDS), geralmente em uma concentração de 1% por 24 h. No entanto, o SDS pode deixar resíduos no tecido, que podem ser tóxicos para as células semeadas. Portanto, o objetivo do presente estudo foi obter uma matriz extracelular descelularizada de tecido ovariano de bovino com SDS, mas com menor concentração e menor tempo de incubação. Além disso, identificar as moléculas e as funções da MEC nativa e descelularizada. Para isso, ovários de bovino procedentes de abatedouro foram transportados ao laboratório em solução salina a 37 °C. No laboratório, folículos antrais foram puncionados com uma agulha, e a cápsula e a região medular do ovário foram removidas. Fatias (10 mm x 5 mm x 1 mm) foram obtidas da região cortical do ovário, pesadas e distribuídas entre os grupos de tratamento. A solução estoque de SDS foi preparada com 1% de SDS (Sigma-Aldrich, Brasil) e NaOH 0,2M em água destilada e depois diluída até as concentrações desejadas. As concentrações de SDS utilizadas foram 1%, 0,5%, 0,1%, 0,05% e 0,01% e tempos de incubação de 24 h, 12 h e 6 h. As fatias de ovário foram submersas individualmente em 10 mL de cada mistura, sob agitação constante (100 rpm), em temperatura ambiente e pelo período definido para cada tratamento. Em seguida, foram lavadas em 50 ml de água destilada por 6 horas, trocando a água destilada a cada 30 minutos. O tecido obtido de cada tratamento foi analisado por histologia, por eletroforese para avaliar o tamanho dos fragmentos de DNA remanescentes nas fatias ovarianas e por quantificação do DNA pelo Fluorômetro Qubit® 2.0 (Thermo Fisher Scientific). A análise histológica confirmou a descelularização e a coloração com tricrômico de Mallory mostrou a conservação das fibras de colágeno e elastina em todas as amostras após cada tratamento. Além disso, a menor concentração de SDS que não mostrou DNA remanescente na análise de eletroforese foi de 0,1%, quando incubado por 24 h e 12 h, mas não por 6 h. A viabilidade celular mostrou que a MEC descelularizada por incubação em 0,1% de SDS por 12 h não era tóxico para as células ovarinas durante o cultivo in vitro por 24 e 72 h. Também, foram identificadas as moléculas e funções da MEC nativa e descelularizada por 0,1% de SDS por 12 h através de análise da proteômica. Assim, foram identificação 155 proteínas na MEC nativa (87 proteínas centrais e 68 proteínas associadas a matrisome) e 145 proteínas na MEC descelularizada (84 proteínas centrais e 61 proteínas associada a matrisome). Ainda foram identificadas as funções biológicas e celulares das proteínas da MEC nativa e descelularizada. Desta forma, concluímos que o protocolo de 0,1% de SDS por 12 h de incubação descelulariza o tecido ovariano de bovino, gerando uma MEC descelularizada não tóxica para as células ovarianas e conserva as moléculas da MEC descelularizada o mais semelhante possível à MEC nativas.


  • Mostrar Abstract
  • The decellularized extracellular matrix (ECM) of various tissues (heart, lung, kidney, uterus and testis) is allowing the regeneration and recovery of native cells and tissue functions. An alternative to maintain fertility in women diagnosed with cancer, who would become infertile due to chemotherapy and/or radiotherapy, is the development of a transplantable artificial ovary. Decellularized ECM of ovarian tissue was obtained using sodium dodecyl sulfate (SDS), usually at a concentration of 1% for 24 h. However, SDS can leave residues in the tissue, which can be toxic to seeded cells. Therefore, the objective of the present study was to obtain a decellularized extracellular matrix from bovine ovarian tissue with SDS, but with lower concentration and shorter incubation time. In addition, to identify the molecules and functions of the native and decellularized ECM. For this, bovine ovaries from slaughterhouses were transported to the laboratory in saline solution at 37 °C. In the laboratory, antral follicles were punctured with a needle, and the capsule and medullary region of the ovary were removed. Slices (10 mm x 5 mm x 1 mm) were obtained from the cortical region of the ovary, weighed and distributed among the treatment groups. The SDS stock solution was prepared with 1% SDS (Sigma-Aldrich, Brazil) and 0.2M NaOH in distilled water and then diluted to the desired concentrations. The SDS concentrations used were 1%, 0.5%, 0.1%, 0.05% and 0.01% and incubation times of 24 h, 12 h and 6 h. The ovary slices were individually submerged in 10 mL of each mixture, under constant agitation (100 rpm), at room temperature and for the period defined for each treatment. Then, they were washed in 50 ml of distilled water for 6 hours, changing the distilled water every 30 minutes. The tissue obtained from each treatment was analyzed by histology, by electrophoresis to assess the size of the DNA fragments remaining in the ovarian slices, and by DNA quantification using the Qubit® 2.0 Fluorometer (Thermo Fisher Scientific). Histological analysis confirmed decellularization and staining with Mallory's trichrome showed the conservation of collagen and elastin fibers in all samples after each treatment. In addition, the lowest concentration of SDS that did not show remaining DNA in the electrophoresis analysis was 0.1%, when incubated for 24 h and 12 h, but not for 6 h. Cell viability showed that MEC decellularized by incubation in 0.1% SDS for 12 h was not toxic to ovarian cells during in vitro cultivation for 24 and 72 h. Also, the molecules and functions of the native and decellularized ECM by 0.1% SDS for 12 h were identified through proteomics analysis. Thus, 155 proteins were identified in native ECM (87 core proteins and 68 matrisome-associated proteins) and 145 proteins in decellularized ECM (84 core proteins and 61 matrisome-associated proteins). The biological and cellular functions of native and decellularized ECM proteins were also identified. Thus, we conclude that the 0.1% SDS protocol for 12 h of incubation decellularizes the bovine ovarian tissue, generating a non-toxic decellularized ECM for ovarian cells and preserves the decellularized ECM molecules as similar as possible to the native ECM.

2022
Dissertações
1
  • LETÍCIA PRATES MARTINS
  • Uso do FSH recombinante humano na produção in vitro de embriões bovinos.

  • Orientador : JOÃO HENRIQUE MOREIRA VIANA
  • MEMBROS DA BANCA :
  • JOÃO HENRIQUE MOREIRA VIANA
  • JOAO GABRIEL VIANA DE GRAZIA
  • MARGOT ALVES NUNES DODE
  • RICARDO ALAMINO FIGUEIREDO
  • Data: 15/07/2022

  • Mostrar Resumo
  • A produção in vitro de embriões (PIVE) de bovinos está em constante crescimento, e o desenvolvimento de novos protocolos é importante para a melhoria dos índices de produção, o que pode permitir o escalonamento da técnica. Dentre as etapas da PIVE, a maturação in vitro (MIV) é considerada essencial, pois ocorrem alterações no ovócito que permitem que a fecundação ocorra com sucesso e inicia-se o processo de desenvolvimento embrionário. In vitro, o FSH é necessário nas primeiras horas da MIV e, convencionalmente, os meios de maturação são suplementados com FSH de hipófise suína. Entretanto, esse extrato não possui uma padronização entre as partidas, possui contaminação de outros hormônios, como o LH, e encontra-se, atualmente, excasso no mercado. Em 1988 foi produzido o primeiro FSH recombinante humano. Através dessa tecnologia é possível produzir a molécula em grande escala, com alta pureza e sem variabilidade na composição. Existem algumas formulações de rhFSH disponíveis no mercado, como as folitropinas alfa, beta e delta. A folitropina alfa é utilizada na rotina clínica na reprodução humana desde 1995. Atualmente, essa molécula vem despertando interesse para uso na área animal, devido a sua padronização entre doses, pureza e meia vida mais prolongada. Nosso estudo avaliou o uso de FSH suíno (pFSH) ou folitropinaalfa (rhFSH), durante a maturação in vitro (MIV) de complexos cumulus-oócitos (COC) recuperados de bovinos Nelore (Bos taurus indicus). Foram realizados quatro experimentos, todos usando CCO grau I (n = 11.245) submetidos a MIV em TCM199 sem FSH (-FSH) ou suplementados com 0,5 μg/mL de pFSH (Folltropin-V, Exp. 1 a 4) ou 0,1 UI rhFSH (Gonal-F, Exp. 2, 3 e 4). Foram feitas avaliações da expansão do cumulus, produção de blastocisto, criotolerância, contagem de células e taxa de prenhez. A expansão do cumulus foi maior (P<0,0001) na presença de pFSH, independentemente da concentração de SFB. FSH e o SFB aumentaram as taxas de clivagem e blastocisto (P<0,05), mas nenhuma interação entre eles foi observada (P>0,05). No Exp. 2, CCO (n=2.791) foram maturados na ausência de FSH (-FSH) ou com pFSH ou rhFSH, e foram submetidos à PIVE. Blastocistos foram avaliados para eclosão como frescos ou após vitrificação e desvitrificação (ou reaquecimento). A expansão do cumulus e as taxas de blastocisto foram maiores (P<0,05) nos grupos tratados com FSH (pFSH e rhFSH) do que sem FSH (-FSH). No entanto, não houve efeito do tratamento (P>0,05) nas taxas de eclosão de blastocistos frescos ou vitrificados. No Exp. 3, CCO (n=720) foram maturados nos grupos -FSH, pFSH ou rhFSH, e os blastocistos expandidos produzidos foram corados com Hoechst 33342 e iodeto de propídio. Blastocistos do grupo rhFSH apresentaram mais células no trofoblasto (P=0,0002), mas não na MCI (P=0,3231), quando comparados aos grupos pFSH e - FSH. No Exp. 4, usamos o mesmo desenho experimental do Exp. 2 mas em uma rotina comercial de PIVE, que incluiu o uso de CCO recuperado por OPU e sêmen sexado de macho, e a transferência de parte dos blastocistos produzidos. Tanto o pFSH quanto o rhFSH aumentaram as taxas de clivagem (P=0,0035) e de blastocistos (P=0,0102), mas não a taxa de prenhez (P=0,1080), em comparação com -FSH. Em resumo, a folitropina-alfa é uma alternativa ao pFSH como suplemento para MIV de CCO bovino.


  • Mostrar Abstract
  • The in vitro embryo production (IVEP) of bovines is constantly growing, and the development of new protocols is important for the improvement of production rates, which may allow the scaling up of the technique. Among the steps of IVEP, in vitro maturation (IVM) is considered essential, as changes occur in the oocyte that allow fertilization to occur successfully and the process of embryonic development begins. In vitro, FSH is required within the first few hours of IVM, and conventionally, maturation media are supplemented with porcine pituitary FSH. However, this extract does not have a standardization between the batches, it has contamination of other hormones, such as LH, and is currently scarce on the market. In 1988 the first human recombinant FSH was produced. Through this technology it is possible to produce the molecule on a large scale, with high purity and without variability in composition. There are some rhFSH formulations available on the market, such as follitropins alpha, beta and delta. Follitropin alfa has been used in clinical routine in human reproduction since 1995. Currently, this molecule is attracting interest for use in the animal area, due to its standardization between doses, purity and longer half-life. Our study evaluated the use of porcine FSH (pFSH) or follitropin-alpha (rhFSH) during in vitro maturation (IVM) of cumulus-oocyte complexes (COC) recovered from Nelore cattle (Bos taurus indicus). Four experiments were performed, all using grade I COC (n = 11,245) subjected to IVM in TCM199 without FSH (-FSH) or supplemented with 0.5 μg/mL pFSH (Folltropin-V, Exp. 1 to 4) or 0 .1 IU rhFSH (Gonal-F, Exp. 2, 3 and 4). Assessments were made of cumulus expansion, blastocyst production, cryotolerance, cell count and pregnancy rate. Cumulus expansion was higher (P<0.0001) in the presence of pFSH, regardless of FBS concentration. FSH and FBS increased cleavage and blastocyst rates (P<0.05), but no interaction between them was observed (P>0.05). In Exp. 2, COC (n=2,791) were matured in the absence of FSH (-FSH) or with pFSH or rhFSH, and underwent IVP. Blastocysts were assessed for hatching as fresh or after vitrification and devitrification (or rewarming). Cumulus expansion and blastocyst rates were higher (P<0.05) in groups treated with FSH (pFSH and rhFSH) than without FSH (-FSH). However, there was no treatment effect (P>0.05) on hatching rates of fresh or vitrified blastocysts. In Exp. 3, COC (n=720) were matured in the -FSH, pFSH or rhFSH groups, and the expanded blastocysts produced were stained with Hoechst 33342 and propidium iodide. Blastocysts from the rhFSH group showed more cells in the trophoblast (P=0.0002), but not in the ICM (P=0.3231), when compared to the pFSH and -FSH groups. In Exp. 4, we use the same experimental design as Exp. 2 but in a commercial IVP routine, which included the use of OPU recovered by OPU and male sexed semen, and the transfer of part of the blastocysts produced. Both pFSH and rhFSH increased cleavage (P=0.0035) and blastocyst rates (P=0.0102), but not pregnancy rate (P=0.1080), compared to -FSH. In summary, follitropin-alpha is an alternative to pFSH as a supplement for bovine COC IVM.

2
  • RODRIGO MARTINS DE MOURA
  • CORIFOLITROPINA-ALFA NA ESTIMULAÇÃO OVARIANA DE FÊMEAS BOVINAS PRÉ-PÚBERES

  • Orientador : JOÃO HENRIQUE MOREIRA VIANA
  • MEMBROS DA BANCA :
  • JOÃO HENRIQUE MOREIRA VIANA
  • CARLOS ANTÔNIO DE CARVALHO FERNANDES
  • CARLOS FREDERICO MARTINS
  • EDUARDO DE OLIVEIRA MELO
  • Data: 17/08/2022

  • Mostrar Resumo
  • Os primeiros estudos com estimulação e produção in vitro de embriões em bezerras pré-púberes foram realizados na década de 1990. Como naquela época não era possível predizer o valor genético de um animal antes do início da vida produtiva, o tema recebeu pouca atenção. Com o advento dos marcadores genéticos e a evolução na eficiência da Produção in vitro de Embriões (PIVE) esse tema voltou a ser alvo de estudos. O objetivo desse trabalho foi avaliar uma molécula de hormônio folículo estimulante recombinante humano (rhFSH) de longa ação, a corifolitropina-alfa, em bezerras da raça Nelore (Bos taurus indicus) e novilhas prépúberes utilizada em um programa de PIVE. O presente experimento envolveu três etapas, objetivando estabelecer o protocolo a ser utilizado para a administração do rhFSH, e avaliar a pré-estimulação com rhFSH antes da aspiração folicular (OPU) em bezerras e em novilhas pré-púberes. Foi realizado um ensaio preliminar de resposta para definir a dose a ser utilizada (10 mcg). Em seguida, bezerrasforam alocadas aleatoriamente para receber rhFSH por via SC (n=5) ou IM (n=5). O desenvolvimento folicular ovariano foi monitorado diariamente por ultrassonografia por cinco dias. Em ambos os grupos o diâmetro médio do folículo aumentou (P<0,0001) de 0h a 96h após o tratamento, estabilizando-se a partir de então. Em um segundo momento, já com a dose e via de aplicação já definidas, o protocolo foi utilizado em programas de PIVE em fazendas comerciais. No experimento 2, bezerras (n=90) foram distribuídos aleatoriamente em 5 grupos: 1) GC: bezerras sem pré-estimulação; 2) rhFSH-96h: rhFSH SC e OPU 96h depois; 3) rhFSH-120h: rhFSH SC e OPU 120h depois; 4) eCG-96h: 300 UI eCG IM e OPU 96h depois; e 5) eCG-120h: 300 UI eCG IM e OPU 120h depois. Vacas nelore (n=10) foram utilizadas como referência para os resultados do PIVE. O pré-tratamento com rhFSH aumentou a proporção de complexos cumulus-oócitos (COC) grau I em comparação com eCG ou controles (P<0,0001), e no rhFSH-120h a taxa de blastocisto foi semelhante à de vacas maduras (P>0,05). No entanto, rhFSH aumentou a proporção de COC expandidos e diminuiu a proporção de COC viáveis (P<0,0001). No Experimento 3, novilhas pré-púberes (n=60) foram tratadas ou não (grupo controle) com rhFSH, e a OPU foi realizada 72 ou 96 horas depois. O intervalo entre o tratamento e a aspiração do folículo não afetou nenhum parâmetro analisado. Novilhas pré-tratadas com rhFSH apresentaram maior proporção de COC grau I (P=0,0188) e taxa de blastocisto (P<0,0098). No entanto, este grupo apresentou menor nümero de COC viáveis (P=0,0264), resultando em quantidade semelhante (P=0,5869) de embriões produzidos por doadora/OPU. A taxa de prenhez também foi semelhante entre os grupos controle e rhFSH (19,3 vs. 25,0%, P=0,4142). Em resumo, o tratamento com uma única injeção SC de corifolitropina-alfa foi eficaz para promover a superestimulação em bezerros. No entanto, os potenciais benefícios dos protocolos préestimulatórios usando rhFSH foram compensados por uma diminuição no número total de COC viáveis recuperados, não aumentando o número de embriões produzidos por doadora/OPU.


  • Mostrar Abstract
  • The first studies with stimulation and in vitro production of embryos in pre pubertal heifers were conducted in the 1990s. As at that time it was not possible to predict the genetic value of an animal before the beginning of productive life, the theme received little attention. With the advent of genetic markers and the evolution in the efficiency of in vitro embryo production (PIVE) this theme has been again the target of studies. The objective of this work was to evaluate a long-action human recombinant recombinant follicle hormone (rhFSH) molecule, alpha corifolitropin, in Nellore (Bos taurus indicus) and pre pubertal heifers used in an in vitro embryo production (IVEP) program. The present experiment involved three stages, aiming to establish the protocol to be used for the administration of rhFSH, and to evaluate the pre-stimulation with rhFSH before follicular aspiration (OPU) in heifers and pre pubertal heifers. A preliminary response test was performed to define the dose to be used (10 mcg). Then, heifers were randomly allocated to receive rhFSH via SC (n=5) or IM (n=5). Ovarian follicular development was monitored daily by ultrasound for five days. In both groups the average diameter of the follicle increased (P<0.0001) from 0h to 96h after treatment, stabilizing from then on. In a second moment, already with the dose and application route already defined, the protocol was used in PIVE programs in commercial farms. In experiment 2, heifers (n=90) were randomly distributed into 5 groups: 1) CG: heifers without pre-stimulation; 2) rhFSH-96h: rhFSH SC and OPU 96h later; 3) rhFSH-120h: rhFSH SC and OPU 120h later; 4) eCG-96h: 300 IU eCG IM and OPU 96h later; and 5) eCG120h: 300 IU eCG IM and OPU 120h later. Nellore cows (n=10) were used as a reference for the IVEP results. Pretreatment with rhFSH increased the proportion of cumulus-oocytes (COC) grade I complexes compared to eCG or controls (P<0.0001), and in rhFSH-120h the blastocyst rate was similar to that of mature cows (P>0.05) However, rhFSH increased the proportion of expanded COC and decreased the proportion of viable COC (P<0.0001). In Experiment 3, pre pubertal heifers (n=60) were treated or not (control group) with rhFSH, and OPU was performed 72 or 96 hours later. The interval between treatment and follicle aspiration did not affect any parameters analyzed. Heifers pretreated with rhFSH showed a higher proportion of COC grade I (P=0.0188) and blastocyst rate (P<0.0098). However, this group presented lower number of viable COC (P=0.0264), resulting in a similar amount (P=0.5869) of embryos produced by donor/OPU. The pregnancy rate was also similar between the control and rhFSH groups (19.3 vs. 25.0%, P=0.4142). In summary, treatment with a single SC injection of corifolitropin-alpha was effective in promoting overstimulation in calves. However, the potential benefits of pre-stimulator protocols using rhFSH were offset by a decrease in the total number of viable COC recovered, not increasing the number of embryos produced per donor/OPU.

3
  • Isabella Monteiro Gomes da Silva
  • "Efeito da incubação do tecido ovariano de gata doméstica em eritropoietina após criopreservação e xenotransplante”

  • Orientador : FERNANDA PAULINI
  • MEMBROS DA BANCA :
  • FERNANDA PAULINI
  • DANIELA MARA DE OLIVEIRA
  • MONICA PEREIRA GARCIA
  • ANA PAULA RIBEIRO RODRIGUES
  • Data: 23/08/2022

  • Mostrar Resumo
  • Grande parte das espécies felinas encontram-se ameaçadas de extinção. Assim, a criação de bancos de germoplasma se faz necessária e aponta para a importância de técnicas eficazes de criopreservação e xenotransplante de tecido ovariano, para posterior produção de embriões in vitro. No entanto, a criopreservação e o período de isquemia/reperfusão após o transplante ainda são um desafio, pois desencadeiam uma massiva perda folicular. Assim, a eritropoietina (EPO), pode ser considerada uma possível alternativa para amenizar essas injúrias e preservar os folículos devido aos seus efeitos angiogênicos, anti-apoptóticos e antioxidantes. O presente estudo avaliou a eficácia da incubação de tecidos ovarianos de gatas domésticas em eritropoietina antes e depois da criopreservação. Para isso, os ovários recebidos de uma clínica veterinária foram seccionados e divididos aleatoriamente entre os grupos denominados EPO+CRIO (incubados em EPO e criopreservados em seguida) e CRIO+EPO (criopreservados, descongelados e incubados em EPO), nos quais a incubação foi realizada em MEM e 100 UI de EPO por duas horas à 37°C (antes ou depois da criopreservação), e no grupo denominado CRIO, em que os fragmentos foram somente criopreservados igualmente por congelamento lento. Os fragmentos descongelados dos três grupos foram xenotransplantados para a região subcutânea dorsal de camundongas nude Swiss (nu/nu) e recuperados aos 7, 14, 21 e 28 dias pós-transplante. Foram realizadas análises histológicas e histoquímicas para a contagem e classificação de folículos e mensuração de áreas de fibrose, e testes imunohistoquímicos para averiguar a presença de vasos sanguíneos e avaliar os folículos proliferativos. A EPO se mostrou eficaz na sobrevivência folicular quando utilizada após a criopreservação, e apresentou o aumento de vasos sanguíneos no grupo EPO+CRIO aos 21 dias pós-transplante. Assim, é possível inferir que a EPO mostrou efeitos benéficos, mas estudos futuros são necessários para maior comprovação da eficácia dos protocolos apresentados.


  • Mostrar Abstract
  • The majority of felines are threatened with extinction. Thus, the creation of cryobanks is necessary, which highlights the importance of efficient cryopreservation and xenotransplantation protocols for in vitro embryo production. However, both cryopreservation and the ischemia/reperfusion period are still a challenge, because they trigger a massive follicular loss. Erythropoietin (EPO) can be used to reduce those injuries and preserve follicles due to its angiogenic, anti-apoptotic, and antioxidant effects. The present study evaluated the effectiveness of cat ovarian tissue incubation in EPO before or after cryopreservation. Ovaries received from a veterinary clinic were segmented and randomly divided into groups: EPO+CRYO (incubated in EPO and cryopreserved immediately after), CRYO+EPO (cryopreserved, thawed, then incubated in EPO), in which incubation was performed in MEM and 100 IU of EPO for 2 hours at 37°C (either before or after cryopreservation), and group CRIO, in which fragments were only cryopreserved. Thawed tissue from the three groups were xenotransplanted into subcutaneous dorsal tissue of nude Swiss (nu/nu) mice and retrieved 7, 14, 21 and 28 after surgery. Histological and histochemistry analyses were performed for follicle counting, classification, and the measurement of fibrotic areas, and immunohistochemistry assays were performed to investigate the presence of new vessels and proliferative follicles. EPO proved to be effective for follicle survival when used after cryopreservation and showed an increase in the number of blood vessels in the EPO+CRIO group 21 days after transplantation. Therefore, EPO showed beneficial effects, but future studies are necessary to further examine the effectiveness and optimize the protocols presented.

4
  • Natalia Ernandes Capobianco
  • "Dna livre de célula no plasma seminal de touros nelore: possível marcador para qualidade e congelabilidade do sêmen"

  • Orientador : MARGOT ALVES NUNES DODE
  • MEMBROS DA BANCA :
  • MAURÍCIO MACHAIM FRANCO
  • JOSE FELIPE WARMLING SPRICIGO
  • LIGIANE DE OLIVEIRA LEME
  • MARGOT ALVES NUNES DODE
  • Data: 31/08/2022

  • Mostrar Resumo
  • A criopreservação de sêmen é uma técnica de grande impacto utilizada na produção animal. Apesar de bem estabelecida em algumas espécies, a resposta à criopreservação e a capacidade de produzir embriões in vitro varia de indivíduo para indivíduo. Assim, a identificação de um marcador que possa indicar a congelabilidade e fecundidade da amostra, antes do congelamento, seria de grande valia para a indústria de sêmen. Buscando uma nova avaliação que possa predizer a qualidade espermática pós-descongelamento, este estudo avaliou a quantidade de DNA livre de células e o número de cópias de mtDNA no plasma seminal de touros Nelore. O sêmen de nove touros foi coletado por eletroejaculação, metade do ejaculado foi utilizado para avaliação do sêmen fresco e obtenção do plasma seminal para quantificação de cfDNA, a outra metade foi criopreservada. A avaliação de movimento espermático pelo CASA (IVOS 12.3/Hamilton-Thorne, EUA) e da integridade e estabilidade da membrana plasmática, integridade acrossomal, apoptose e potencial mitocondrial, por citometria de fluxo, (AMNIS FlowSight - Amnis Corp., EUA) foram realizados no sêmen fresco e sêmen congelado/descongelado às 0, 3, 6 e 12h após o descongelamento. O sêmen criopreservado também foi utilizado para a produção de embriões in vitro. A quantificação de cfDNA foi realizada por espectrofotometria e o número de cópias do mtDNA foi quantificado por qPCR. A concentração de cfDNA presente no plasma seminal variou de 15,23 ng/μL a 519,71 ng/μL. A mediana foi calculada (58,95) e dois grupos foram definidos de acordo com a concentração de cfDNA: LowcfDNA (<58,95 ng/μL; n=5) e HighcfDNA (>58,95 ng/μL; n=4). O número de cópias de mtDNA foi semelhante (P>0,05) entre os grupos. No sêmen fresco, a porcentagem de células com estabilidade de membrana foi maior (P<0,05) no grupo LowcfDNA (84,24%) comparado ao grupo HighcfDNA (52,72%) e, ao longo de 12 horas pósdescongelamento, não houve diferenças para todos os parâmetros avaliados entre os grupos. A taxa de clivagem e de blastocistos em D7 foi maior para o grupo HighcfDNA (60.74% ± 3.38 e 24.95% ± 2.56, respectivamente), do que para o grupo LowcfDNA (41.21% ± 3.23 e 6.42 ± 1.14). O grupo HighcfDNA também produziu embriões de melhor qualidade. A concentração de cfDNA no plasma seminal não é capaz de predizer a congelabilidade do sêmen, mas animais com maior quantidade de cfDNA são capazes de produzir in vitro mais embriões e de melhor qualidade.


  • Mostrar Abstract
  • Sperm cryopreservation is a great impact technique used in animal production. Although it is well established in some species, the response to cryopreservation is varies depending on individual. Thus, the identification of a marker that can indicate the freezeability and fecundity of the sample, prior to freezing, would be of great value to the semen industry. Them, searching for a new assessment that can predict post-thawing sperm quality, this study evaluated the amount of cellfree DNA and mtDNA copy number in the seminal plasma of Nellore bulls. Semen from nine bulls was collected by electroejaculation, half of the ejaculate was used to fresh semen evaluation and obtain seminal plasma for cfDNA quantification, the other half was cryopreserved. Evaluation of sperm movement by CASA (IVOS 12.3/Hamilton-Thorne, USA) and of plasma membrane integrity and stability, acrosomal integrity, apoptosis, and mitochondrial potential by flow cytometry (AMNIS FlowSight - Amnis Corp., USA) were performed on fresh semen and frozen/thawed semen at 0, 3, 6 and 12h after thawing. Cryopreserved semen was also used for in vitro embryo production. Quantification of cfDNA was performed by spectrophotometry and the mtDNA copy number was quantified by qPCR. The concentration of cfDNA present in seminal plasma ranged from 15.23 ng/μL to 519.71 ng/μL. The median was calculated (58.95) and two groups were defined according to cfDNA concentration: LowcfDNA (<58.95 ng/μL; n=5) and HighcfDNA (>58.95 ng/μL; n=4). The mtDNA copy number was similar (P>0.05) between groups. In fresh semen, the percentage of cells with membrane stability was higher (P<0.05) in the LowcfDNA group (84.24%) compared to the HighcfDNA group (52.72%) and, over 12 hours post-thawing, there were no differences for all parameters evaluated between groups. Cleavage and D7 blastocyst rates were higher for the HighcfDNA group (60.74% ± 3.38 and 24.95% ± 2.56, respectively) than for the LowcfDNA group (41.21% ± 3.23 and 6.42 ± 1.14). The HighcfDNA group also produced better quality embryos. The concentration of cfDNA in seminal plasma is not able to predict the freezeability of semen, but animals with a greater amount of cfDNA are able to produce more embryos and of better quality in vitro.

5
  • GIOVANNA DE CARVALHO NARDELI BASÍLIO LÔBO
  • Avaliação do Potencial antitumoral de nanorods de óxido de cobre em tumores de mama.

  • Orientador : SONIA NAIR BAO
  • MEMBROS DA BANCA :
  • SONIA NAIR BAO
  • LUIS ALEXANDRE MUEHLMANN
  • LAISE RODRIGUES DE ANDRADE
  • APARECIDO RIBEIRO DE SOUZA
  • Data: 09/12/2022

  • Mostrar Resumo
  • O câncer, sendo um conjunto de doenças responsáveis pela segunda maior causa de morte global é um dos principais problemas de saúde pública atualmente. O câncer de mama, apresenta a letalidade mais elevada quando comparada aos demais tipos de câncer e se destaca principalmente em mulheres. O diagnóstico precoce em conjunto com a melhor escolha de alternativas terapêuticas é fundamental para o sucesso do tratamento. A nanotecnologia vem sendo desenvolvida e ganhando destaque para o diagnóstico precoce, entrega direcionada e biocompatibilidade celular. Com isso, o presente trabalho sugere a avaliação do potencial anti-tumoral de nanorods de óxido de cobre com citrato (CuO-nr cit) para o tratamento de câncer de mama. Foram utilizadas duas diferentes linhagens de carcinoma mamário humano (MCF-7 e MDA-MB-231) e uma linhagem de origem epitelial de glandula mamária humano não tumoral (MCF10A). As CuO-nr foram obtidas por meio de uma reação de cloreto de cobre com hidróxido de sódio. Posteriormente, a amostra permaneceu em diálise por 48 horas. CuO-nr cit apresentou diâmetro hidrodinâmico de 107.1 ± 0.67nm e potencial zeta de -23.8 ± -1.87 mV. Nos estudos in vitro a linhagem MCF-7 apresentou uma redução significativa (~60%) da viabilidade celular após tratamento com CuO-nr cit, fato não observado na linhagem não tumoral (MCF10A) e na linhagem tumoral MDA-MB-231. Pode-se observar por microscopia eletrônica de varredura e de luz a alteração da morfologia celular das células tratadas.


  • Mostrar Abstract
  • Cancer, being a set of diseases responsible for the second leading cause of global death, is one of the main public health problems today. Early diagnosis together with the best choice of therapeutic alternatives is essential for successful treatment. Breast cancer has the highest lethality when compared to other types of cancer and stands out mainly in women. Nanotechnology has been developed and gaining prominence for early diagnosis, targeted delivery and cellular biocompatibility. Thus, the present work suggests the evaluation of the antitumor potential of copper oxide nanorods with citrate (CuO-nr cit) for the treatment of breast cancer. Two different human breast carcinoma strains (MCF-7 and MDA-MB-231) and a non-tumor human mammary gland epithelial lineage (MCF10A) were used. CuO-nr were obtained through a reaction of copper chloride with sodium hydroxide. Subsequently, the sample remained on dialysis for 48 hours. CuO-nr cit had a hydrodynamic diameter of 107.1 ± 0.67nm and a zeta potential of -23.8 ± -1.87 mV. In in vitro studies, the MCF-7 strain showed a significant reduction in cell viability (~60%) after treatment with CuO-nr cit, which was not observed in the non-tumor strain (MCF 10A) and tumor lineage MDAMB-231. By scanning electron and light microscopy, the alteration of the cellular morphology of the treated cells can be observed.

Teses
1
  • Nayara Ribeiro Kussano
  • MARCADORES BIOQUÍMICOS PARA A COMPETÊNCIA OVOCITÁRIA EM BOVINOS

  • Orientador : MARGOT ALVES NUNES DODE
  • MEMBROS DA BANCA :
  • MARGOT ALVES NUNES DODE
  • CAROLINA MADEIRA LUCCI
  • IVO PIVATO
  • JOSE FELIPE WARMLING SPRICIGO
  • MAURÍCIO MACHAIM FRANCO
  • Data: 16/12/2022

  • Mostrar Resumo
  • Este estudo teve como objetivo avaliar características bioquímicas do ambiente folicular na capacidade do ovócito de formar embrião e identificar marcadores para selecionar ovócitos mais competentes. Inicialmente foi avaliado se a fonte proteica (FP) utilizada durante a maturação in vitro (MIV) afetariam o sexo / desenvolvimento do embrião e o perfil de expressão de genes candidatos nas CC. Ovócitos bovinosforam maturados e cultivados na presença de soro fetal bovino (SFB) ou albumina sérica bovina (BSA), biopsias de CC foram removidas antes e após a MIV, e após a fecundação e o cultivo, as CCsforam agrupadas de acordo com seu resultado em: CCs de CCOs imaturos e CCs de CCOs maturados que resultaram ou não em embriões. O efeito da FP durante a MIV foi determinado pela quantificação de transcritos dos genes, GPC4, VCAN, GHR, PTGS2 e ALCAM. Os resultados mostraram que a FP afeta a produção de embriões se o SFB for usado tanto na MIV quanto no CIV. No entanto, quando o embrião é cultivado em BSA, a FP durante a MIV não tem nenhum efeito. Além disso, a FP durante a MIV afeta a expressão dos genes VCAN, GHR, PTGS2 e ALCAM nas CCs, e apenas o gene GHR foi expresso de forma diferente (P <0,05) em CC imaturas do grupo que deu embrião, mas apenas quando SFB foi usado na MIV. Na segunda parte do estudo características bioquímicas do ambiente folicular que contêm ovócitos capazes ou não de formar embrião. Folículos de 5-6mm foram dissecados e de cada folículo foram coletados individualmente amostras de líquido folicular (LF), células da granulosa (CG), CC imaturas e maturadas, e os CCOs foram utilizados para a produção de embriões. No D8 de acordo com o resultado as amostras foram agrupadas em: as que os ovócitos originaram embrião (EMB) e as que não originaram (NEMB). Nas CC imaturas e maturas e CGs foi analisada por qPCR a expressão de 8 genes: CASP3, SERPINE2, VCAN, LUM, FSHR, EGFR, PGR e GHR. E no LF foi avaliado DNA livre de células (cfDNA), por quantificação das sequencias de ART2 e BOVTA por qPCR e a concentração de progesterona e estradiol por quimiluminescência e eletroquimioluminescência, respectivamente. Dos 8 genes avaliados, o gene GHR apresentou maior quantidade de transcritos em CC imaturas de CCOs do grupo EMB, CASP3 apresentou maior expressão em CC maturas do grupo NEMB, e os genes CASP3 e GHR apresentaram aumento no nível de transcritos durante a MIV apenas no grupo NEMB, já o gene VCAN apresentou aumento durante a MIV nas CC do grupo EMB. As análises das amostras de LF, mostraram maior quantidade (P<0.05) de cfDNA somente do gene ART2 no LF do grupo NEMB comparado ao EMB. A concentração de progesterona no LF foi similar entre os grupos, enquanto a de estradiol foi maior (P<0,05) no grupo EMB, consequentemente maior relação P4/E2 foi encontrada no grupo EMB (P<0,05). Conclui-se que, que a FP durante a MIV pode afetar a expressão de genes candidatos. E, que maior nível de transcritos de GHR em CC imaturas, a menor expressão de CASP3 em CC maturas, a alto nível do gene ART2, a concentração de Estradiol e a relação de P4/E2 no LF podem indicar ovócitos com maior potencial de desenvolvimento.


  • Mostrar Abstract
  • This study aimed to evaluate biochemical characteristics of the follicular environment on the ability of the oocyte to form an embryo and to identify markersto select more competent oocytes. Initially, it was evaluated whether the protein source (FP) used during in vitro maturation (IVM) would affect the sex / development of the embryo and the expression profile of candidate genes in cumulus cells (CC). Bovine oocytes were matured and cultured in the presence of fetal bovine serum (FBS) or bovine serum albumin (BSA), CC biopsies were removed before and after IVM, and after fertilization and culture, CCs were grouped according to their result in: CCs from immature COCs and CCs from mature COCs that did or did not result in embryos. The effect of FP during IVM was determined by quantification of gene transcripts, GPC4, VCAN, GHR, PTGS2 and ALCAM. Results showed that FP affects embryo production if FBS is used in both IVM and IVC. However, when the embryo is cultured in BSA, FP during IVM has no effect. Furthermore, FP during IVM affects the expression of the VCAN, GHR, PTGS2 and ALCAM genes in CCs, and only the GHR gene was expressed differently (P <0.05) in immature CCs from the group that gave embryo, but only when FBS was used on the IVM. In the second part of the study, biochemical characteristics of the follicular environment containing oocytes capable or not of forming an embryo. Follicles of 5-6mm were dissected and from each follicle samples of follicular fluid (LF), granulosa cells (GC), immature and mature CC were collected individually, and the COCs were used to produce embryos. On D8, according to the result, the samples were grouped into: those that the oocytes originated in the embryo (EMB) and those that did not (NEMB). In immature and mature CCs and GCs, the expression of 8 genes was analyzed by qPCR: CASP3, SERPINE2, VCAN, LUM, FSHR, EGFR, PGR and GHR. And in the LF, cell-free DNA (cfDNA) was evaluated by quantification of ART2 and BOVTA sequences by qPCR and the concentration of progesterone and estradiol by chemiluminescence and electrochemiluminescence, respectively. Of the 8 genes evaluated, the GHR gene showed a higher amount of transcripts in immature CCs of CCOs from the EMB group, CASP3 showed a higher expression in mature CCs from the NEMB group, and the CASP3 and GHR genes showed an increase in the level of transcripts during IVM only in the NEMB group, whereas the VCAN gene showed an increase during IVM in CCs from the EMB group. The analyzes of the LF samples showed a higher amount (P<0.05) of cfDNA only from the ART2 gene in the LF from the NEMB group compared to the EMB. The concentration of progesterone in LF was similar between the groups, while that of estradiol was higher (P<0.05) in the EMB group, consequently a higher P4/E2 ratio was found in the EMB group (P<0.05). It is concluded that FP during IVM can affect the expression of candidate genes. And, that a higher level of GHR transcripts in immature CCs, lower CASP3 expression in mature CCs, a high level of the ART2 gene, Estradiol concentration and the P4/E2 ratio in the LF may indicate oocytes with greater development potential.

2
  • Maria de Sousa Brito Neta
  • AVALIAÇÃO E CARACTERIZAÇÃO DE C-DOTS COM OLEOS ESSENCIAIS DE CRAVO, CITRONELA E LARANJA PARA APLICAÇÕES BIOLOGICAS – UM ESTUDO COM LARVAS DE Zophobas morio.

  • Orientador : RICARDO BENTES DE AZEVEDO
  • MEMBROS DA BANCA :
  • RICARDO BENTES DE AZEVEDO
  • MONICA PEREIRA GARCIA
  • DANIEL DIAS RUFINO ARCANJO
  • MICHEL MUÁLEM DE MORAES ALVES
  • PATRICIA BENTO DA SILVA
  • Data: 23/12/2022

  • Mostrar Resumo
  • Visando a utilização de produtos que permitam uma sustentabilidade econômica, ambiental e com baixa agressão para aplicação em humanos, utilizamos a nanotecnologia com carbon dots associada aos óleos essenciais, os quais possuem diversas aplicações biológicas e propriedades microbiológicas e antioxidantes. Assim, o objetivo principal deste trabalho foi funcionalizar nanopartículas de carbon dots (DOTS) com óleos essenciais de: citronela (Cymbopogon winterianus)-(DCIT), cravo da índia (Eugenia caryophyllus)-(DCRA), e laranja (Citrus sinensis)-(DLAR) para aplicação em produtos nanoestruturados de baixo custo, que promovam uma maior solubilidade, melhor estabilidade molecular e menor toxicidade, em relação aos produtos já existentes no mercado. Antes da funcionalização dos DOTS, foi determinado o grau de pureza de cada óleo utilizado no trabalho por análise de Cromatografia gasosa acoplada por espectrometria de massas (CG-EM). Após a obtenção das nanopartículas funcionalizadas, todas as formulações foram submetidas a técnicas de caracterizações físico-químicas com os ensaios de termogravimetria (TG), espectroscopia por UV-Vis, infravermelho com transformada de Fourier (FTIR) e por RAMAN, assim como a microscopia de transmissão (MET) para a avaliação do tamanho, teste de estabilidade pela avaliação da variação do pH, bem como a presença de antioxidantes por técnica de ressonância paramagnética eletrônica (EPR). Como modelo para os testes in vivo foi utilizado larvas de Zophobas morio (Tenebrio Gigante) e avaliado a toxicidade em 24 e 48h após administração, e alguns parâmetros de marcadores antioxidantes como Nitrito, Mieloperoxidase (MPO) e Glutationa Reduzida (GSH) e Melanização como parâmetro indicativo de toxicidade. Os óleos apresentaram um grau de pureza superior a 85%. Para os compostos majoritários dos óleos de cravo da índia as moléculas de eugenol com 85% de pureza e β-cariofileno 11%. O óleo de laranja representado pelo limoneno apresentou 97% de grau de pureza. Para o óleo de citronela as três moléculas mais representativas com seu grau de pureza respectivamente são o citronelal 41%, geraniol 23% e citronelol 8,6%. Dados das análises de RAMAN mostraram que os DOTS em temperatura ambiente apresentaram um aumento no teor de defeitos estruturais com o decorrer do tempo, provavelmente devido a processos oxidativos induzidos pelo oxigênio do meio; por outro lado a presença do óleo na superfície dos DOTS promoveu uma estabilidade nas ligações com os óleos em temperatura ambiente, para DCRA foi sugestivo de uma estabilidade de seis meses e as demais formulações DLAR e DCIT de aproximadamente doze meses. Nos ensaios de FTIR os espectros de absorção exibiram uma forte banda em ~1450 cm-1, associada com modos de estiramento simétrico da carboxila. Modos vibracionais νas¿ e ν ¿C=O) podem ser encontrados em 1670 e 1715 cm-1, respectivamente, deslocamento para maiores energias assim como o aumento das intensidades dos modos associados aos grupos oxigenados indicando mais uma vez a oxidação da superfície dos DOTS, corroborando com os resultados do RAMAN. No UV-Vis, os espectros de absorção dos DOTS, DLAR e DCIT, apresentaram uma banda de absorção típica em 337 nm, atribuída a transição n–π* (ligações C=O) e um ombro em torno de 240 nm, atribuído a transição π-π* (C=C ligações com hibridização sp2), diferentemente no DCRA não foi observado o ombro em torno de 238 nm, atribuído as transições π-π*, e sim apresentou um pico atípico, em 279 nm . Para a determinação das capacidades antioxidantes por meio do EPR foi encontrado que apenas a formulação DCRA apresentou uma potencial capacidade antioxidante, enquanto os DOTS, DLAR e DCIT, com o comportamento semelhante, apresentaram em média um decaimento de 100 para 60% no consumo de DPPH, mostrando um grau de eficácia inferior. Não foi observado morte in vivo após 48h de administração das formulações, e a produção de radicais livres e antioxidantes associados a Nitrito, GDH e MPO foram dependentes das concentrações das formulações. Para a detecção do Nitrito apenas duas formulações apresentaram alterações; o DCRA nas concentrações de 25 e 100 mg/g de animal e o DCIT em 25 e 50 mg/g. Alterações nos valores de GSH foi observado nas formulações DCRA em 25 mg/g, DOTS em 50 e 100mg/g e DLAR em 50mg/g. Os níveis da MPO se mostraram alterados em todas as concentrações de DOTS e DCIT testada, e para formulação do DCRA apenas em 50mg/g de animal. A melanização apresentou alterações apenas à formulação DCRA nas concentrações de 50 e 25 mg/g de animal. Assim, podemos concluir que a funcionalização dos DOTS com os óleos essenciais usados neste estudo se mostrou eficaz, podendo reduzir a toxicidade e aumentar a capacidade antioxidante dos mesmos para potenciais aplicações em produtos biocompatíveis.


  • Mostrar Abstract
  • Seeking at the use of raw material or products that allow an economic, environmental sustainability and low toxicity for human’s application, we use nanotechnology based in carbon dots, associated with essential oils which have several biological applications with microbiological and antioxidant properties. Thus, the main objective of this work was to functionalize carbon dot nanoparticles-(DOTS) with three essential oils: citronella (Cymbopogon winterianus) – (DCIT); clove (Eugenia caryophyllus) - (DCRA), and orange (Citrus sinensis) - (DLAR) that could promote a greater solubility, better molecular stability and lower toxicity for the oils and DOTS. The degree of purity of each oil used in the work was determined by gas chromatography coupled with mass spectrometry (GC-MS) analysis. After nanoparticles functionalization’s, all formulations were analyzed by thermogravimetry (TG), UV-Vis spectroscopy, Fourier transform infrared spectroscopy (FTIR) and RAMAN to determine their physicochemical parameters, as well as transmission microscopy (MET) for size evaluation, pH variation, and presence of antioxidants by magnetic resonance technique (EPR). The Zophobas morio larvae (superworms) was the in vivo model used to evaluate toxicity and antioxidant markers such as Nitrite, Myeloperoxidase (MPO) and Reduced Glutathione (GSH) and Melanization. The oils purity was more than 85%. For the major compounds of clove oils, eugenol purity was 85% and β- Caryophyllene 11%. The orange oil represented by limonene presented 97% purity. For citronella oil the three most representative molecules with their purity degree respectively are citronellal 41%, geraniol 23% and citronellol 8.6%. Data from RAMAN analyses showed that DOTS at room temperature showed an increase in the content of structural defects over time, due to oxidative processes induced by oxygen in the medium; on the other hand, the presence of oil on the surface of DOTS promoted a stability in the bonds with the oils, for DCRA it was six months and the DLAR and DCIT formulations were of twelve months. FTIR data show additional spectra bands in ~1450 cm-1, associated with symmetrical carboxyl stretch modes. Vibrational modes νas¿ and ν ¿C=O) can be found in 1670 cm- and 1715cm-1, respectively, displacement to higher energies as well as the increase in the intensities of the modes associated with the oxygenated groups, indicating once again the oxidation of the DOTS surface. In the UV-Vis analyzes, the absorption spectra of DOTS, DLAR and DCIT, presented a typical absorption band at 337 nm as a n–π* transition (C=O bonds) and a shoulder around 240 nm, attributed to the π-π* transition (C=C bonds with sp2 hybridization); in the DCRA, the shoulder around 238 nm was not observed, for transitions π-π*, but it was presented an atypical peak, at 279 nm. It was found that only the DCRA formulation presented a potential antioxidant, while DOTS, DLAR and DCIT, with similar behavior, the decay average was from 100 to 60% in the consumption of DPPH showing a lower degree of antioxidant effect. No death was observed in vivo studies after 48h of formulation administration, and the production of free radicals and antioxidants associated with Nitrite, GDH and MPO were dependent on the concentrations of each formulations. For the detection of Nitrite, only two formulations presented alterations; DCRA at concentrations of 25 and 100 mg/g of animal and DCIT at 25 and 50 mg/g. Changes in GSH values were observed in the DCRA at 25 mg/g, DOTS at 50 and 100mg/g and DLAR in 50mg/g. MPO levels were altered in all concentrations of DOTS and DCIT tested, and for DCRA only in 50mg/g of animal. Melanization presented alterations only to the Formulation DCRA at concentrations of 50 and 25 mg/g of animal. The results presented, demonstrated that the carbon-dots functionalized with essential oils used in this study can produce DOTS with reduced toxicity and a better antioxidant property for potential applications in biocompatible products.

SIGAA | Secretaria de Tecnologia da Informação - STI - (61) 3107-0102 | Copyright © 2006-2026 - UFRN - app40.sigaa40